PDB entry 1vc2

View 1vc2 on RCSB PDB site
Description: Crystal structure of Glyceraldehyde 3-Phosphate Dehydrogenase from Thermus thermophilus HB8
Class: oxidoreductase
Keywords: glyceraldehyde 3-phosphate dehydrogenase, Thermus thermophilus, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, OXIDOREDUCTASE
Deposited on 2004-03-04, released 2004-03-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.225
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glyceraldehyde 3-phosphate dehydrogenase
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1vc2a1, d1vc2a2
  • Heterogens: NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vc2A (A:)
    mkvgingfgrigrqvfrilhergvevalindltdnktlahllkydstygrfpgavgydee
    nlyvdgkairataikdpreipwkqagvgvvvestgvftdgekarahleagakkviitapa
    kneditvvlgvnheqydpakhhilsnascttnslapvmkvlekafgvekalmttvhsytn
    dqrlldlphkdlrraraaalniiptttgaakatalvlpslkgrfdgmalrvptptgsisd
    itallkrevtaeevnaalkaaaegplkgilaytedeivlrdivmdphssivdgkltkaig
    nlvkvfawydnewgyanrvadlvelvlkkgv