PDB entry 1vc1

View 1vc1 on RCSB PDB site
Description: Crystal structure of the TM1442 protein from Thermotoga maritima, a homolog of the Bacillus subtilis general stress response anti-anti-sigma factor RsbV
Class: gene regulation
Keywords: anti-anti-sigma factor, gene regulation
Deposited on 2004-03-03, released 2004-09-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.205
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Putative anti-sigma factor antagonist TM1442
  Species: Thermotoga maritima [TaxId:2336]
  Gene: TM1442
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9X1F5 (0-109)
  Domains in SCOPe 2.07: d1vc1a_
• Chain 'B':
  Compound: Putative anti-sigma factor antagonist TM1442
  Species: Thermotoga maritima [TaxId:2336]
  Gene: TM1442
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9X1F5 (0-109)
  Domains in SCOPe 2.07: d1vc1b_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1vc1A (A:)
  mnnlkldiveqddkaivrvqgdidaynsselkeqlrnfisttskkkivldlssvsymdsa
  glgtlvvilkdakingkefilsslkesisrilklthldkifkitdtveea
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1vc1B (B:)
  mnnlkldiveqddkaivrvqgdidaynsselkeqlrnfisttskkkivldlssvsymdsa
  glgtlvvilkdakingkefilsslkesisrilklthldkifkitdtveea