PDB entry 1vbz

View 1vbz on RCSB PDB site
Description: Crystal Structure of the Hepatitis Delta Virus Gemonic Ribozyme Precursor, with C75U mutaion, in Ba2+ solution
Class: translation/RNA
Keywords: HDV, ribozyme, RNA, U1A, precursor, TRANSLATION/RNA COMPLEX
Deposited on 2004-03-03, released 2004-05-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.253
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: U1 small nuclear ribonucleoprotein A
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09012
      • engineered (30)
      • engineered (35)
    Domains in SCOPe 2.08: d1vbza_
  • Chain 'B':
    Compound: Hepatitis Delta virus ribozyme
    Species: synthetic, synthetic
  • Heterogens: BA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1vbzA (A:)
mavpetrpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifk
evssatnalrsmqgfpfydkpmriqyaktdsdiiakmkgt

    Sequence, based on observed residues (ATOM records): (download) 
    >1vbzA (A:)
petrpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifkevs
satnalrsmqgfpfydkpmriqyaktdsdiiakmk

  • Chain 'B':
    No sequence available.