PDB entry 1vbv

View 1vbv on RCSB PDB site
Description: Crystal structure of hypothetical protein from Esherichia coli
Class: unknown function
Keywords: protein degradation, structural genomics, UNKNOWN FUNCTION
Deposited on 2004-03-02, released 2005-10-04
Made obsolete by 5ycq on 2018-04-11

The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.228
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein b0966
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vbva1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vbvA (A:)
    miaskfgigqqvrhsllgylgvvvdidpvyslsepspdelavndelraapwyhvvmeddn
    glpvhtylaeaqlsselqdehpeqpsmdelaqtirkqlqaprlrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vbvA (A:)
    askfgigqqvrhsllgylgvvvdidpvaapwyhvvmeddnglpvhtylaeaqlsselqde
    hpeqpsmdelaqtirkq