PDB entry 1vbu

View 1vbu on RCSB PDB site
Description: Crystal structure of native xylanase 10B from Thermotoga maritima
Class: hydrolase
Keywords: xylanase 10B, hydrolase
Deposited on 2004-03-02, released 2005-06-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.186
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endo-1,4-beta-xylanase B
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vbua_
  • Chain 'B':
    Compound: endo-1,4-beta-xylanase B
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vbub_
  • Heterogens: SO4, ACY, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vbuA (A:)
    sqnvslrelaeklniyigfaainnfwslsdaekymevarrefniltpenqmkwdtihper
    drynftpaekhvefaeendmivhghtlvwhnqlpgwitgrewtkeellnvledhiktvvs
    hfkgrvkiwdvvneavsdsgtyresvwyktigpeyiekafrwakeadpdailiyndysie
    einaksnfvynmikelkekgvpvdgigfqmhidyrglnydsfrrnlerfaklglqiyite
    mdvriplsgseeyylkkqaevcakifdicldnpavkaiqfwgftdkyswvpgffkgygka
    llfdenynpkpcyyaikevlekkieerk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vbuA (A:)
    vslrelaeklniyigfaainnfwslsdaekymevarrefniltpenqmkwdtihperdry
    nftpaekhvefaeendmivhghtlvwhnqlpgwitgrewtkeellnvledhiktvvshfk
    grvkiwdvvneavsdsgtyresvwyktigpeyiekafrwakeadpdailiyndysieein
    aksnfvynmikelkekgvpvdgigfqmhidyrglnydsfrrnlerfaklglqiyitemdv
    riplsgseeyylkkqaevcakifdicldnpavkaiqfwgftdkyswvpgffkgygkallf
    denynpkpcyyaikevlekkieer
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vbuB (B:)
    sqnvslrelaeklniyigfaainnfwslsdaekymevarrefniltpenqmkwdtihper
    drynftpaekhvefaeendmivhghtlvwhnqlpgwitgrewtkeellnvledhiktvvs
    hfkgrvkiwdvvneavsdsgtyresvwyktigpeyiekafrwakeadpdailiyndysie
    einaksnfvynmikelkekgvpvdgigfqmhidyrglnydsfrrnlerfaklglqiyite
    mdvriplsgseeyylkkqaevcakifdicldnpavkaiqfwgftdkyswvpgffkgygka
    llfdenynpkpcyyaikevlekkieerk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vbuB (B:)
    vslrelaeklniyigfaainnfwslsdaekymevarrefniltpenqmkwdtihperdry
    nftpaekhvefaeendmivhghtlvwhnqlpgwitgrewtkeellnvledhiktvvshfk
    grvkiwdvvneavsdsgtyresvwyktigpeyiekafrwakeadpdailiyndysieein
    aksnfvynmikelkekgvpvdgigfqmhidyrglnydsfrrnlerfaklglqiyitemdv
    riplsgseeyylkkqaevcakifdicldnpavkaiqfwgftdkyswvpgffkgygkallf
    denynpkpcyyaikevlekkieer