PDB entry 1vbp

View 1vbp on RCSB PDB site
Description: Crystal structure of artocarpin-mannopentose complex
Class: plant protein
Keywords: beta-prism, mannose-specific, lectin, jacalin-like, PLANT PROTEIN
Deposited on 2004-02-28, released 2004-06-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 3.5 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Artocarpin
    Species: Artocarpus integer [TaxId:3490]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1vbpa_
  • Chain 'B':
    Compound: Artocarpin
    Species: Artocarpus integer [TaxId:3490]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1vbpb_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vbpA (A:)
    asqtitvgswggpggngwddgsytgirqielsykeaigsfsviydlngdpfsgpkhtskl
    pyknvkielkfpdeflesvsgytgpfsalatptpvvrsltfktnkgrtfgpygdeegtyf
    nlpienglivgfkgrtgdlldaigihmsl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vbpB (B:)
    asqtitvgswggpggngwddgsytgirqielsykeaigsfsviydlngdpfsgpkhtskl
    pyknvkielkfpdeflesvsgytgpfsalatptpvvrsltfktnkgrtfgpygdeegtyf
    nlpienglivgfkgrtgdlldaigihmsl