PDB entry 1vbo

View 1vbo on RCSB PDB site
Description: Crystal structure of artocarpin-mannotriose complex
Class: plant protein
Keywords: beta-prism, mannose-specific, lectin, jacalin-like, PLANT PROTEIN
Deposited on 2004-02-28, released 2004-06-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.209
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Artocarpin
    Species: Artocarpus integer [TaxId:3490]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1vboa_
  • Chain 'B':
    Compound: Artocarpin
    Species: Artocarpus integer [TaxId:3490]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1vbob_
  • Chain 'C':
    Compound: Artocarpin
    Species: Artocarpus integer [TaxId:3490]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1vboc_
  • Chain 'D':
    Compound: Artocarpin
    Species: Artocarpus integer [TaxId:3490]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1vbod_
  • Chain 'E':
    Compound: Artocarpin
    Species: Artocarpus integer [TaxId:3490]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1vboe_
  • Chain 'F':
    Compound: Artocarpin
    Species: Artocarpus integer [TaxId:3490]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1vbof_
  • Chain 'G':
    Compound: Artocarpin
    Species: Artocarpus integer [TaxId:3490]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1vbog_
  • Chain 'H':
    Compound: Artocarpin
    Species: Artocarpus integer [TaxId:3490]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1vboh_
  • Heterogens: MAN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vboA (A:)
    asqtitvgpwggpggngwddgsytgirqielsykeaigsfsviydlngdpfsgpkhtskl
    pyknvkielkfpdeflesvsgytgpfsalatptpvvrsltfktnkgrtfgpygdeegtyf
    nlpienglivgfkgrtgdlldaigihmsl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vboB (B:)
    asqtitvgpwggpggngwddgsytgirqielsykeaigsfsviydlngdpfsgpkhtskl
    pyknvkielkfpdeflesvsgytgpfsalatptpvvrsltfktnkgrtfgpygdeegtyf
    nlpienglivgfkgrtgdlldaigihmsl
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vboC (C:)
    asqtitvgpwggpggngwddgsytgirqielsykeaigsfsviydlngdpfsgpkhtskl
    pyknvkielkfpdeflesvsgytgpfsalatptpvvrsltfktnkgrtfgpygdeegtyf
    nlpienglivgfkgrtgdlldaigihmsl
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vboD (D:)
    asqtitvgpwggpggngwddgsytgirqielsykeaigsfsviydlngdpfsgpkhtskl
    pyknvkielkfpdeflesvsgytgpfsalatptpvvrsltfktnkgrtfgpygdeegtyf
    nlpienglivgfkgrtgdlldaigihmsl
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vboE (E:)
    asqtitvgpwggpggngwddgsytgirqielsykeaigsfsviydlngdpfsgpkhtskl
    pyknvkielkfpdeflesvsgytgpfsalatptpvvrsltfktnkgrtfgpygdeegtyf
    nlpienglivgfkgrtgdlldaigihmsl
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vboF (F:)
    asqtitvgpwggpggngwddgsytgirqielsykeaigsfsviydlngdpfsgpkhtskl
    pyknvkielkfpdeflesvsgytgpfsalatptpvvrsltfktnkgrtfgpygdeegtyf
    nlpienglivgfkgrtgdlldaigihmsl
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vboG (G:)
    asqtitvgpwggpggngwddgsytgirqielsykeaigsfsviydlngdpfsgpkhtskl
    pyknvkielkfpdeflesvsgytgpfsalatptpvvrsltfktnkgrtfgpygdeegtyf
    nlpienglivgfkgrtgdlldaigihmsl
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vboH (H:)
    asqtitvgpwggpggngwddgsytgirqielsykeaigsfsviydlngdpfsgpkhtskl
    pyknvkielkfpdeflesvsgytgpfsalatptpvvrsltfktnkgrtfgpygdeegtyf
    nlpienglivgfkgrtgdlldaigihmsl