PDB entry 1vbm

View 1vbm on RCSB PDB site
Description: Crystal structure of the Escherichia coli tyrosyl-tRNA synthetase complexed with Tyr-AMS
Class: ligase
Keywords: LIGASE, Structural Genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2004-02-27, released 2005-01-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.246
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosyl-tRNA synthetase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vbma_
  • Chain 'B':
    Compound: Tyrosyl-tRNA synthetase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vbmb_
  • Heterogens: SO4, YSA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vbmA (A:)
    nlikqlqerglvaqvtdeealaerlaqgpialycgfdptadslhlghlvpllclkrfqqa
    ghkpvalvggatgligdpsfkaaerklnteetvqewvdkirkqvapfldfdcgensaiaa
    nnydwfgnmnvltflrdigkhfsvnqminkeavkqrlnredqgisftefsynllqgydfa
    clnkqygvvlqiggsdqwgnitsgidltrrlhqnqvfgltvplitkadgtkfgkteggav
    wldpkktspykfyqfwintadadvyrflkfftfmsieeinaleeedknsgkapraqyvla
    eqvtrlvhgeeglqaakr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vbmB (B:)
    nlikqlqerglvaqvtdeealaerlaqgpialycgfdptadslhlghlvpllclkrfqqa
    ghkpvalvggatgligdpsfkaaerklnteetvqewvdkirkqvapfldfdcgensaiaa
    nnydwfgnmnvltflrdigkhfsvnqminkeavkqrlnredqgisftefsynllqgydfa
    clnkqygvvlqiggsdqwgnitsgidltrrlhqnqvfgltvplitkadgtkfgkteggav
    wldpkktspykfyqfwintadadvyrflkfftfmsieeinaleeedknsgkapraqyvla
    eqvtrlvhgeeglqaakr