PDB entry 1vbk

View 1vbk on RCSB PDB site
Description: Crystal structure of PH1313 from Pyrococcus horikoshii Ot3
Class: structural genomics, unknown function
Keywords: Pyrococcus horikoshii, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, NPPSFA, National Project on Protein Structural and Functional Analyses, UNKNOWN FUNCTION
Deposited on 2004-02-27, released 2005-04-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.199
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein PH1313
    Species: Pyrococcus horikoshii [TaxId:70601]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1vbka1, d1vbka2
  • Chain 'B':
    Compound: hypothetical protein PH1313
    Species: Pyrococcus horikoshii [TaxId:70601]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1vbkb1, d1vbkb2
  • Heterogens: MRD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vbkA (A:)
    mnvvivrygeigtksrqtrswfekilmnnirealvteevpykeifsrhgriivktnspke
    aanvlvrvfgivsispameveaslekinrtallmfrkkakevgkerpkfrvtarritkef
    pldsleiqakvgeyilnnencevdlknydieigieimqgkayiytekikgwgglpigteg
    rmigilhdelsalaiflmmkrgvevipvyigkddknlekvrslwnllkrysygskgflvv
    aesfdrvlklirdfgvkgvikglrpndlnsevseitedfkmfpvpvyyplialpeeyiks
    vkerlgl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vbkB (B:)
    mnvvivrygeigtksrqtrswfekilmnnirealvteevpykeifsrhgriivktnspke
    aanvlvrvfgivsispameveaslekinrtallmfrkkakevgkerpkfrvtarritkef
    pldsleiqakvgeyilnnencevdlknydieigieimqgkayiytekikgwgglpigteg
    rmigilhdelsalaiflmmkrgvevipvyigkddknlekvrslwnllkrysygskgflvv
    aesfdrvlklirdfgvkgvikglrpndlnsevseitedfkmfpvpvyyplialpeeyiks
    vkerlgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vbkB (B:)
    mnvvivryksrqtrswfekilmnnirealvteevpykeifsrhgriivktnspkeaanvl
    vrvfgivsispameveaslekinrtallmfrkkakevgkerpkfrvtarritkefpldsl
    eiqakvgeyilnnencevdlknydieigieimqgkayiytekikgwgglpigtegrmigi
    lhdelsalaiflmmkrgvevipvyigkddknlekvrslwnllkrysygskgflvvaesfd
    rvlklirdfgvkgvikglrpvseitedfkmfpvpvyyplialpeeyiksvkerlgl