PDB entry 1vbj

View 1vbj on RCSB PDB site
Description: The crystal structure of prostaglandin F synthase from Trypanosoma brucei
Class: oxidoreductase
Keywords: tim barrel, oxidoreductase
Deposited on 2004-02-27, released 2005-04-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.208
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: prostaglandin F synthase
    Species: Trypanosoma brucei [TaxId:5691]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9GV41 (5-280)
      • cloning artifact (0-4)
    Domains in SCOPe 2.07: d1vbja1, d1vbja2
  • Chain 'B':
    Compound: prostaglandin F synthase
    Species: Trypanosoma brucei [TaxId:5691]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9GV41 (5-280)
      • cloning artifact (2-4)
    Domains in SCOPe 2.07: d1vbjb1, d1vbjb2
  • Heterogens: NAP, CIT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vbjA (A:)
    gspefmaltqslklsngvmmpvlgfgmwklqdgneaetatmwaiksgyrhidtaaiykne
    esagraiascgvpreelfvttklwnsdqgyestlsafeksikklgleyvdlylihwpgkd
    kfidtwkafeklyadkkvraigvsnfhehhieellkhckvapmvnqielhpllnqkalce
    yckskniavtawsplgqghlvedarlkaiggkygktaaqvmlrweiqagvitipksgnea
    rikengnifdfeltaediqvidgmnaghrygpdpevfmndf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vbjB (B:)
    gspefmaltqslklsngvmmpvlgfgmwklqdgneaetatmwaiksgyrhidtaaiykne
    esagraiascgvpreelfvttklwnsdqgyestlsafeksikklgleyvdlylihwpgkd
    kfidtwkafeklyadkkvraigvsnfhehhieellkhckvapmvnqielhpllnqkalce
    yckskniavtawsplgqghlvedarlkaiggkygktaaqvmlrweiqagvitipksgnea
    rikengnifdfeltaediqvidgmnaghrygpdpevfmndf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vbjB (B:)
    pefmaltqslklsngvmmpvlgfgmwklqdgneaetatmwaiksgyrhidtaaiyknees
    agraiascgvpreelfvttklwnsdqgyestlsafeksikklgleyvdlylihwpgkdkf
    idtwkafeklyadkkvraigvsnfhehhieellkhckvapmvnqielhpllnqkalceyc
    kskniavtawsplgqghlvedarlkaiggkygktaaqvmlrweiqagvitipksgneari
    kengnifdfeltaediqvidgmnaghrygpdpevfmndf