PDB entry 1vbi

View 1vbi on RCSB PDB site
Description: Crystal structure of type 2 malate/lactate dehydrogenase from thermus thermophilus HB8
Class: oxidoreductase
Keywords: malate dehydrogenase, NAD(P) binding protein, thermus thermophilus HB8, Structural Genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, OXIDOREDUCTASE
Deposited on 2004-02-27, released 2005-04-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.187
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Type 2 malate/lactate dehydrogenase
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vbia_
  • Heterogens: SO4, NAD, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vbiA (A:)
    mrwradflsawaeallrkagadepsakavawalveadlrgvgshgllrlpvyvrrleagl
    vnpsptlpleergpvalldgehgfgprvalkaveaaqslarrhglgavgvrrsthfgmag
    lyaeklaregfvawvttnaepdvvpfggrekalgtnplafaapapqgilvadlatsesam
    gkvflarekgerippswgvdregsptddphrvyalrplggpkgyalallvevlsgvltga
    gvahgigrmydewdrpqdvghfllaldpgrfvgkeaflermgalwqalkatppapgheev
    flpgelearrreralaegmalpervvaelkalgerygvpwrdda
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vbiA (A:)
    mrwradflsawaeallrkagadepsakavawalveadlrgvgshgllrlpvyvrrleagl
    vnpsptlpleergpvalldgehgfgprvalkaveaaqslarrhglgavgvrrsthfgmag
    lyaeklaregfvawvttnaepdvvpfggrekalgtnplafaapapqgilvadlatsesam
    gkvflarekgerippswgvdregsptddphrvyalrplggpkgyalallvevlsgvltga
    gvahgigrmydewdrpqdvghfllaldpgrfvgkeaflermgalwqalkatppapgheev
    flpgelearrreralaegmalpervvaelkalgerygvpw