PDB entry 1vbg

View 1vbg on RCSB PDB site
Description: Pyruvate Phosphate Dikinase from Maize
Class: transferase
Keywords: transferase, Maize, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics
Deposited on 2004-02-26, released 2005-03-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pyruvate,orthophosphate dikinase
    Species: Zea mays [TaxId:4577]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11155 (Start-875)
      • see remark 999 (818)
    Domains in SCOPe 2.07: d1vbga1, d1vbga2, d1vbga3
  • Heterogens: MG, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vbgA (A:)
    ttkkrvfhfgkgksegnktmkellggkganlaemasiglsvppgftvsteacqqyqdagc
    alpaglwaeivdglqwveeymgatlgdpqrplllsvrsgaavsmpgmmdtvlnlglndev
    aaglaaksgerfaydsfrrfldmfgnvvmdiprslfeeklehmkeskglkndtdltasdl
    kelvgqykevylsakgepfpsdpkkqlelavlavfnswesprakkyrsinqitglrgtav
    nvqcmvfgnmgntsgtgvlftrnpntgekklygeflvnaqgedvvagirtpedldamknl
    mpqaydelvencnileshykemqdieftvqenrlwmlqcrtgkrtgksavkiavdmvneg
    lveprsaikmvepghldqllhpqfenpsaykdqviatglpaspgaavgqvvftaedaeaw
    hsqgkaailvraetspedvggmhaavgilterggmtshaavvargwgkccvsgcsgirvn
    daeklvtigghvlregewlslngstgevilgkqplsppalsgdlgtfmawvddvrklkvl
    anadtpddaltarnngaqgiglcrtehmffasderikavrqmimaptlelrqqaldrllp
    yqrsdfegiframdglpvtirlldpplheflpegniedivselcaetganqedalariek
    lsevnpmlgfrgcrlgisypeltemqaraifeaaiamtnqgvqvfpeimvplvgtpqelg
    hqvtlirqvaekvfanvgktigykvgtmieipraalvadeiaeqaeffsfgtndltqmtf
    gysrddvgkfipvylaqgilqhdpfevldqrgvgelvkfatergrkarpnlkvgicgehg
    gepssvaffakagldyvscspfrvpiarlaaaqvlv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vbgA (A:)
    kkrvfhfgkgksegnktmkellggkganlaemasiglsvppgftvsteacqqyqdagcal
    paglwaeivdglqwveeymgatlgdpqrplllsvrsgaavsmpgmmdtvlnlglndevaa
    glaaksgerfaydsfrrfldmfgnvvmdiprslfeeklehmkeskglkndtdltasdlke
    lvgqykevylsakgepfpsdpkkqlelavlavfnswesprakkyrsinqitglrgtavnv
    qcmvfgnmgntsgtgvlftrnpntgekklygeflvnaqgedvvagirtpedldamknlmp
    qaydelvencnileshykemqdieftvqenrlwmlqcrtgkrtgksavkiavdmvneglv
    eprsaikmvepghldqllhpqfenpsaykdqviatglpaspgaavgqvvftaedaeawhs
    qgkaailvraetspedvggmhaavgilterggmtshaavvargwgkccvsgcsgirvnda
    eklvtigghvlregewlslngstgevilgkqplsppalsgdlgtfmawvddvrklkvlan
    adtpddaltarnngaqgiglcrtehmffasderikavrqmimaptlelrqqaldrllpyq
    rsdfegiframdglpvtirlldpplheflpegniedivselcaetganqedalariekls
    evnpmlgfrgcrlgisypeltemqaraifeaaiamtnqgvqvfpeimvplvgtpqelghq
    vtlirqvaekvfanvgktigykvgtmieipraalvadeiaeqaeffsfgtndltqmtfgy
    srddvgkfipvylaqgilqhdpfevldqrgvgelvkfatergrkarpnlkvgicgehgge
    pssvaffakagldyvscspfrvpiarlaaaqvlv