PDB entry 1vbf

View 1vbf on RCSB PDB site
Description: Crystal structure of protein L-isoaspartate O-methyltransferase homologue from Sulfolobus tokodaii
Class: transferase
Keywords: trimeric coiled coil assembly, inter-subunit disulfide bridge, protein repair enzyme, TRANSFERASE
Deposited on 2004-02-25, released 2004-08-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.205
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 231aa long hypothetical protein-L-isoaspartate O-methyltransferase
    Species: Sulfolobus tokodaii [TaxId:111955]
    Gene: ST1123
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q972K9 (0-End)
      • see remark 999 (0)
      • modified residue (61)
      • modified residue (103)
      • modified residue (160)
      • modified residue (191)
    Domains in SCOPe 2.07: d1vbfa_
  • Chain 'B':
    Compound: 231aa long hypothetical protein-L-isoaspartate O-methyltransferase
    Species: Sulfolobus tokodaii [TaxId:111955]
    Gene: ST1123
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q972K9 (0-End)
      • see remark 999 (0)
      • modified residue (61)
      • modified residue (103)
      • modified residue (160)
      • modified residue (191)
    Domains in SCOPe 2.07: d1vbfb_
  • Chain 'C':
    Compound: 231aa long hypothetical protein-L-isoaspartate O-methyltransferase
    Species: Sulfolobus tokodaii [TaxId:111955]
    Gene: ST1123
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q972K9 (0-End)
      • see remark 999 (0)
      • modified residue (61)
      • modified residue (103)
      • modified residue (160)
      • modified residue (191)
    Domains in SCOPe 2.07: d1vbfc_
  • Chain 'D':
    Compound: 231aa long hypothetical protein-L-isoaspartate O-methyltransferase
    Species: Sulfolobus tokodaii [TaxId:111955]
    Gene: ST1123
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q972K9 (0-End)
      • see remark 999 (0)
      • modified residue (61)
      • modified residue (103)
      • modified residue (160)
      • modified residue (191)
    Domains in SCOPe 2.07: d1vbfd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vbfA (A:)
    asekeeilrkiktqelaeafnkvdrslflpenlkdyayahthealpilpginttalnlgi
    fmldeldlhkgqkvleigtgigyytaliaeivdkvvsveinekmynyaskllsyynnikl
    ilgdgtlgyeeekpydrvvvwataptllckpyeqlkeggimilpigvgrvqklykvikkg
    nspslenlgevmfgrigglygfyddyddiefrvnklerqiksildnlvkkt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vbfA (A:)
    asekeeilrkiktqelaeafnkvdrslflpenlkdyayahthealpilpginttalnlgi
    fmldeldlhkgqkvleigtgigyytaliaeivdkvvsveinekmynyaskllsyynnikl
    ilgdgtlgyeeekpydrvvvwataptllckpyeqlkeggimilpigvgrvqklykvikkg
    nspslenlgevmfgrigglygfyddyddiefrvnklerqiksil
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vbfB (B:)
    asekeeilrkiktqelaeafnkvdrslflpenlkdyayahthealpilpginttalnlgi
    fmldeldlhkgqkvleigtgigyytaliaeivdkvvsveinekmynyaskllsyynnikl
    ilgdgtlgyeeekpydrvvvwataptllckpyeqlkeggimilpigvgrvqklykvikkg
    nspslenlgevmfgrigglygfyddyddiefrvnklerqiksildnlvkkt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vbfB (B:)
    asekeeilrkiktqelaeafnkvdrslflpenlkdyayahthealpilpginttalnlgi
    fmldeldlhkgqkvleigtgigyytaliaeivdkvvsveinekmynyaskllsyynnikl
    ilgdgtlgyeeekpydrvvvwataptllckpyeqlkeggimilpigvgrvqklykvikkg
    nspslenlgevmfgrigglygfyddyddiefrvnklerqiksildn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1vbfC (C:)
    asekeeilrkiktqelaeafnkvdrslflpenlkdyayahthealpilpginttalnlgi
    fmldeldlhkgqkvleigtgigyytaliaeivdkvvsveinekmynyaskllsyynnikl
    ilgdgtlgyeeekpydrvvvwataptllckpyeqlkeggimilpigvgrvqklykvikkg
    nspslenlgevmfgrigglygfyddyddiefrvnklerqiksildnlvkkt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vbfC (C:)
    asekeeilrkiktqelaeafnkvdrslflpenlkdyayahthealpilpginttalnlgi
    fmldeldlhkgqkvleigtgigyytaliaeivdkvvsveinekmynyaskllsyynnikl
    ilgdgtlgyeeekpydrvvvwataptllckpyeqlkeggimilpigvgrvqklykvikkg
    nspslenlgevmfgrigglygfyddyddiefrvnklerqiksil
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1vbfD (D:)
    asekeeilrkiktqelaeafnkvdrslflpenlkdyayahthealpilpginttalnlgi
    fmldeldlhkgqkvleigtgigyytaliaeivdkvvsveinekmynyaskllsyynnikl
    ilgdgtlgyeeekpydrvvvwataptllckpyeqlkeggimilpigvgrvqklykvikkg
    nspslenlgevmfgrigglygfyddyddiefrvnklerqiksildnlvkkt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vbfD (D:)
    asekeeilrkiktqelaeafnkvdrslflpenlkdyayahthealpilpginttalnlgi
    fmldeldlhkgqkvleigtgigyytaliaeivdkvvsveinekmynyaskllsyynnikl
    ilgdgtlgyeeekpydrvvvwataptllckpyeqlkeggimilpigvgrvqklykvikkg
    nspslenlgevmfgrigglygfyddyddiefrvnklerqiksil