PDB entry 1vbc

View 1vbc on RCSB PDB site
Description: poliovirus (type 3, sabin strain) (p3/sabin, p3/leon/12a(1)b) complexed with r77975
Class: Virus
Keywords: VIRUS COAT PROTEIN, HYDROLASE, THIOL PROTEASE, Icosahedral virus
Deposited on 1996-01-02, released 1996-07-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.289
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '0':
    Compound: poliovirus type 3
    Species: Poliovirus type 3 (strains P3/LEON/37 AND P3/LEON 12A[1]B) [TaxId:12088]
    Database cross-references and differences (RAF-indexed):
    • PDB 1VBC (0-3)
  • Chain '1':
    Compound: poliovirus type 3
    Species: Poliovirus type 3 (strains P3/LEON/37 AND P3/LEON 12A[1]B) [TaxId:12088]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vbc1_
  • Chain '2':
    Compound: poliovirus type 3
    Species: Poliovirus type 3 (strains P3/LEON/37 AND P3/LEON 12A[1]B) [TaxId:12088]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vbc.1
  • Chain '3':
    Compound: poliovirus type 3
    Species: Poliovirus type 3 (strains P3/LEON/37 AND P3/LEON 12A[1]B) [TaxId:12088]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vbc3_
  • Chain '4':
    Compound: poliovirus type 3
    Species: Poliovirus type 3 (strains P3/LEON/37 AND P3/LEON 12A[1]B) [TaxId:12088]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vbc.1
  • Heterogens: MYR, J77

PDB Chain Sequences:

  • Chain '0':
    No sequence available.

  • Chain '1':
    Sequence, based on SEQRES records: (download)
    >1vbc1 (1:)
    giedlisevaqgaltlslpkqqdslpdtkasgpahskevpaltavetgatnplapsdtvq
    trhvvqrrsrsestiesffargacvaiievdneqpttraqklfamwritykdtvqlrrkl
    efftysrfdmeftfvvtanftnannghalnqvyqimyippgaptpkswddytwqtssnps
    ifytygaaparisvpyvglanayshfydgfakvplktdandqigdslysamtvddfgvla
    vrvvndhnptkvtskvriymkpkhvrvwcprppravpyygpgvdyrnnldplsekgltty
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vbc1 (1:)
    qdslpdtkasgpahskevpaltavetgatnplapsdtvqtrhvvqrrsrsestiesffar
    gacvaiievdneqpttraqklfamwritykdtvqlrrklefftysrfdmeftfvvtanft
    nannghalnqvyqimyippgaptpkswddytwqtssnpsifytygaaparisvpyvglan
    ayshfydgfakvplktdandqigdslysamtvddfgvlavrvvndhnptkvtskvriymk
    pkhvrvwcprppravpyygpgvdyrnnldplsekgltty
    

  • Chain '2':
    Sequence, based on SEQRES records: (download)
    >1vbc2 (2:)
    spnveacgysdrvlqltlgnstittqeaansvvaygrwpefirddeanpvdqptepdvat
    crfytldtvmwgkeskgwwwklpdalrdmglfgqnmyyhylgrsgytvhvqcnaskfhqg
    algvfaipeyclagdsdkqrytsyananpgerggkfysqfnkdnavtspkrefcpvdyll
    gcgvllgnafvyphqiinlrtnnsativlpyvnalaidsmvkhnnwgiailplspldfaq
    dssveipitvtiapmcsefnglrnvtapkfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vbc2 (2:)
    acgysdrvlqltlgnstittqeaansvvaygrwpefirddeanpvdqptepdvatcrfyt
    ldtvmwgkeskgwwwklpdalrdmglfgqnmyyhylgrsgytvhvqcnaskfhqgalgvf
    aipeyclagdsdkqrytsyananpgerggkfysqfnkdnavtspkrefcpvdyllgcgvl
    lgnafvyphqiinlrtnnsativlpyvnalaidsmvkhnnwgiailplspldfaqdssve
    ipitvtiapmcsefnglrnvtapkfq
    

  • Chain '3':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vbc3 (3:)
    glpvlntpgsnqyltsdnhqspcaipefdvtppidipgevknmmelaeidtmiplnlest
    krntmdmyrvtlsdsadlsqpilclslspafdprlshtmlgevlnyythwagslkftflf
    cgsmmatgkilvayappgaqpptsrkeamlgthviwdlglqssctmvvpwisnvtyrqtt
    qdsfteggyismfyqtrivvplstpksmsmlgfvsacndfsvrllrdtthisqsa
    

  • Chain '4':
    Sequence, based on SEQRES records: (download)
    >1vbc4 (4:)
    gaqvssqkvgahensnrayggstinyttinyykdsasnaaskqdysqdpskfteplkdvl
    iktapaln
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vbc4 (4:)
    gaqvssqkvgahensstinyttinyykdsasnaaskqdysqdpskfteplkdvliktapa
    ln