PDB entry 1vb8

View 1vb8 on RCSB PDB site
Description: solution structure of vhr1, the first cyclotide from root tissue
Class: plant protein
Keywords: cyclotide, cystine knot, circular, Viola, CCK, PLANT PROTEIN
Deposited on 2004-02-25, released 2004-12-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Viola hederacea root peptide 1
    Species: Viola hederacea [TaxId:180952]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1vb8a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vb8A (A:)
    caescvwipctvtallgcscsnkvcyngip