PDB entry 1vb6

View 1vb6 on RCSB PDB site
Description: Crystal Structure of the heme PAS sensor domain of Ec DOS (oxygen-bound form)
Class: signaling protein
Keywords: heme, pas, sensor, signaling protein
Deposited on 2004-02-24, released 2005-04-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.56 Å
R-factor: 0.214
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Heme pas sensor protein
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vb6a_
  • Chain 'B':
    Compound: Heme pas sensor protein
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vb6b_
  • Heterogens: HEM, OXY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vb6A (A:)
    mgsshhhhhhssglvprgshmrqdaevimkltdadnaadgiffpaleqnmmgavlinend
    evmffnpaaeklwgykreevignnidmliprdlrpahpeyirhnreggkarvegmsrelq
    lekkdgskiwtrfalskvsaegkvyylalvrdasvemaqkeqtrqli
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vb6A (A:)
    giffpaleqnmmgavlinendevmffnpaaeklwgykreevignnidmliprdlrpahpe
    yirhnreggkarvegmsrelqlekkdgskiwtrfalskvsaegkvyylalvrda
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vb6B (B:)
    mgsshhhhhhssglvprgshmrqdaevimkltdadnaadgiffpaleqnmmgavlinend
    evmffnpaaeklwgykreevignnidmliprdlrpahpeyirhnreggkarvegmsrelq
    lekkdgskiwtrfalskvsaegkvyylalvrdasvemaqkeqtrqli
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vb6B (B:)
    giffpaleqnmmgavlinendevmffnpaaeklwgykreevignnidmliprdlrpahpe
    yirhnreggegmsrelqlekkdgskiwtrfalskvsaegkvyylalvrda