PDB entry 1vb5

View 1vb5 on RCSB PDB site
Description: Crystal Structure Analysis of the Pyrococcus horikoshii OT3 translation initiation factor eIF-2B
Class: translation
Keywords: initiation factor, translation
Deposited on 2004-02-22, released 2004-12-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: translation initiation factor eIF-2B
    Species: Pyrococcus horikoshii [TaxId:70601]
    Database cross-references and differences (RAF-indexed):
    • GB NP_142421
    Domains in SCOPe 2.07: d1vb5a_
  • Chain 'B':
    Compound: translation initiation factor eIF-2B
    Species: Pyrococcus horikoshii [TaxId:70601]
    Database cross-references and differences (RAF-indexed):
    • GB NP_142421 (Start-275)
    Domains in SCOPe 2.07: d1vb5b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vb5A (A:)
    mlpervleilremkrerikgaswlakkgaeafltlaeeldeslledaimelreevvkvnp
    smaslynlarfipvtnrrdilksraleflrrmeeakrelasigaqliddgdviithsfss
    tvleiirtakerkkrfkviltesspdyeglhlarelefsgiefevitdaqmglfcreasi
    aivgadmitkdgyvvnkagtyllalachenaipfyvaaetykfhptlksgdvmlmerdli
    rgnvrirnvlfdvtpwkyvrgiitelgivipprdiq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vb5A (A:)
    lpervleilremkrerikgaswlakkgaeafltlaeeldeslledaimelreevvkvnps
    maslynlarfipvtnrrdilksraleflrrmeeakrelasigaqliddgdviithsfsst
    vleiirtakerkkrfkviltesspdyeglhlarelefsgiefevitdaqmglfcreasia
    ivgadmitkdgyvvnkagtyllalachenaipfyvaaetykfhptlksgdvmlmerdlir
    gnvrirnvlfdvtpwkyvrgiitelgivipprdi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vb5B (B:)
    mlpervleilremkrerikgaswlakkgaeafltlaeeldeslledaimelreevvkvnp
    smaslynlarfipvtnrrdilksraleflrrmeeakrelasigaqliddgdviithsfss
    tvleiirtakerkkrfkviltesspdyeglhlarelefsgiefevitdaqmglfcreasi
    aivgadmitkdgyvvnkagtyllalachenaipfyvaaetykfhptlksgdvmlmerdli
    rgnvrirnvlfdvtpwkyvrgiitelgivipprdiq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vb5B (B:)
    lpervleilremkrerikgaswlakkgaeafltlaeeldeslledaimelreevvkvnps
    maslynlarfipvtnrrdilksraleflrrmeeakrelasigaqliddgdviithsfsst
    vleiirtakerkkrfkviltesspdyeglhlarelefsgiefevitdaqmglfcreasia
    ivgadmitkdgyvvnkagtyllalachenaipfyvaaetykfhptlksgdvmlmerdlir
    gnvrirnvlfdvtpwkyvrgiitelgivipprdiq