PDB entry 1vb4

View 1vb4 on RCSB PDB site
Description: T=1 capsid structure of Sesbania mosaic virus coat protein deletion mutant CP-N(delta)36
Class: Virus
Keywords: T=1 capsids, Deletion Mutant, Icosahedral virus
Deposited on 2004-02-21, released 2004-11-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.3 Å
R-factor: 0.255
AEROSPACI score: -1.84 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: coat protein
    Species: Sesbania mosaic virus [TaxId:12558]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1vb4a_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vb4A (A:)
    savqqlqptqagismapsaqgamvrirnpavsssrggitvlthselsaeigvtdsivvss
    elvmpytvgtwlrgvaanwskyswlsvrytyipscpsstagsihmgfqydmadtvpvsvn
    qlsnlrgyvsgqvwsgsaglcfingtrcsdtstaisttldvsklgkkwypyktsadyata
    vgvdvniatplvparlvialldgssstavaagriyctytiqmieptasalnn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vb4A (A:)
    gitvlthselsaeigvtdsivvsselvmpytvgtwlrgvaanwskyswlsvrytyipscp
    sstagsihmgfqydmadtvpvsvnqlsnlrgyvsgqvwsgsaglcfingtrcsdtstais
    ttldvsklgkkwypyktsadyatavgvdvniatplvparlvialldgssstavaagriyc
    tytiqmieptasalnn