PDB entry 1vb2

View 1vb2 on RCSB PDB site
Description: T=1 capsid structure of Sesbania mosaic virus coat protein deletion mutant CP-N(delta)65-D146N-D149N
Class: Virus
Keywords: T=1 capsids, Calcium mutant, Icosahedral virus
Deposited on 2004-02-21, released 2004-11-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-07.
Experiment type: XRAY
Resolution: 3.4 Å
R-factor: 0.261
AEROSPACI score: -1.88 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: coat protein
    Species: Sesbania mosaic virus [TaxId:12558]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9EB06
      • engineered (80)
      • engineered (83)
    Domains in SCOPe 2.06: d1vb2a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vb2A (A:)
    avsssrggitvlthselsaeigvtdsivvsselvmpytvgtwlrgvaanwskyswlsvry
    tyipscpsstagsihmgfqynmantvpvsvnqlsnlrgyvsgqvwsgsaglcfingtrcs
    dtstaisttldvsklgkkwypyktsadyatavgvdvniatplvparlvialldgssstav
    aagriyctytiqmieptasalnn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vb2A (A:)
    gitvlthselsaeigvtdsivvsselvmpytvgtwlrgvaanwskyswlsvrytyipscp
    sstagsihmgfqynmantvpvsvnqlsnlrgyvsgqvwsgsaglcfingtrcsdtstais
    ttldvsklgkkwypyktsadyatavgvdvniatplvparlvialldgssstavaagriyc
    tytiqmieptasa