PDB entry 1vb0

View 1vb0 on RCSB PDB site
Description: Atomic resolution structure of atratoxin-b, one short-chain neurotoxin from Naja atra
Class: toxin
Keywords: Short-chain neurotoxin, Three-finger toxin
Deposited on 2004-02-20, released 2004-12-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 0.92 Å
R-factor: 0.114
AEROSPACI score: 1.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cobrotoxin b
    Species: Naja atra [TaxId:8656]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vb0a_
  • Heterogens: SO4, TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vb0A (A:)
    lechnqqssqtpttktcsgetncykkwwsdhrgtiiergcgcpkvkpgvnlnccttdrcn
    n