PDB entry 1vaz

View 1vaz on RCSB PDB site
Description: Solution structures of the p47 SEP domain
Class: lipid binding protein
Keywords: beta-beta-beta-alpha-alpha-beta, novel fold, LIPID BINDING PROTEIN
Deposited on 2004-02-20, released 2004-04-06
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NSFL1 cofactor p47
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1vaza_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1vazA (A:)
mrgshhhhhhgserrrhsgqdvhvvlklwktgfsldngdlrsyqdpsnaqflesirrgev
paelrrlahggqvnldmedhrdedfvkp

    Sequence, based on observed residues (ATOM records): (download) 
    >1vazA (A:)
errrhsgqdvhvvlklwktgfsldngdlrsyqdpsnaqflesirrgevpaelrrlahggq
vnldmedhrdedfvkp