PDB entry 1vaz

View 1vaz on RCSB PDB site
Description: solution structures of the p47 sep domain
Deposited on 2004-02-20, released 2004-04-06
The last revision prior to the SCOP 1.69 freeze date was dated 2004-04-27, with a file datestamp of 2004-04-27.
Experiment type: NMR10
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1vaza_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vazA (A:)
    mrgshhhhhhgserrrhsgqdvhvvlklwktgfsldngdlrsyqdpsnaqflesirrgev
    paelrrlahggqvnldmedhrdedfvkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vazA (A:)
    errrhsgqdvhvvlklwktgfsldngdlrsyqdpsnaqflesirrgevpaelrrlahggq
    vnldmedhrdedfvkp