PDB entry 1vay

View 1vay on RCSB PDB site
Description: Crystal Structure of Uricase from Arthrobacter globiformis with inhibitor 8-azaxanthine
Class: Oxidoreductase
Keywords: Oxidoreductase
Deposited on 2004-02-19, released 2005-06-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.24 Å
R-factor: 0.197
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uric acid oxidase
    Species: Arthrobacter globiformis [TaxId:1665]
    Database cross-references and differences (RAF-indexed):
    • PDB 1VAY (0-286)
    Domains in SCOPe 2.07: d1vaya1, d1vaya2
  • Chain 'B':
    Compound: Uric acid oxidase
    Species: Arthrobacter globiformis [TaxId:1665]
    Database cross-references and differences (RAF-indexed):
    • PDB 1VAY (0-286)
    Domains in SCOPe 2.07: d1vayb1, d1vayb2
  • Chain 'C':
    Compound: Uric acid oxidase
    Species: Arthrobacter globiformis [TaxId:1665]
    Database cross-references and differences (RAF-indexed):
    • PDB 1VAY (0-286)
    Domains in SCOPe 2.07: d1vayc1, d1vayc2
  • Chain 'D':
    Compound: Uric acid oxidase
    Species: Arthrobacter globiformis [TaxId:1665]
    Database cross-references and differences (RAF-indexed):
    • PDB 1VAY (0-286)
    Domains in SCOPe 2.07: d1vayd1, d1vayd2
  • Chain 'E':
    Compound: Uric acid oxidase
    Species: Arthrobacter globiformis [TaxId:1665]
    Database cross-references and differences (RAF-indexed):
    • PDB 1VAY (0-286)
    Domains in SCOPe 2.07: d1vaye1, d1vaye2
  • Chain 'F':
    Compound: Uric acid oxidase
    Species: Arthrobacter globiformis [TaxId:1665]
    Database cross-references and differences (RAF-indexed):
    • PDB 1VAY (0-286)
    Domains in SCOPe 2.07: d1vayf1, d1vayf2
  • Chain 'G':
    Compound: Uric acid oxidase
    Species: Arthrobacter globiformis [TaxId:1665]
    Database cross-references and differences (RAF-indexed):
    • PDB 1VAY (0-286)
    Domains in SCOPe 2.07: d1vayg1, d1vayg2
  • Chain 'H':
    Compound: Uric acid oxidase
    Species: Arthrobacter globiformis [TaxId:1665]
    Database cross-references and differences (RAF-indexed):
    • PDB 1VAY (0-286)
    Domains in SCOPe 2.07: d1vayh1, d1vayh2
  • Heterogens: AZA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vayA (A:)
    tkvvlgqnqygkaevrlvkvtrntarheiqdlnvtsqlrgdfeaahtagdnahvvatdtq
    kntvyafardgfatteefllrlgkhftegfdwvtggrwaaqqffwdrindhdhafsrnks
    evrtavleisgseqaivagiegltvlkstgsefhgfprdkyttlqettdrilatdvsarw
    ryntvevdfdavyasvrglllkafaethslalqqtmyemgraviethpeideikmslpnk
    hhflvdlqpfgqdnpnevfyaadrpyglieatiqregsradhpiwsn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vayB (B:)
    tkvvlgqnqygkaevrlvkvtrntarheiqdlnvtsqlrgdfeaahtagdnahvvatdtq
    kntvyafardgfatteefllrlgkhftegfdwvtggrwaaqqffwdrindhdhafsrnks
    evrtavleisgseqaivagiegltvlkstgsefhgfprdkyttlqettdrilatdvsarw
    ryntvevdfdavyasvrglllkafaethslalqqtmyemgraviethpeideikmslpnk
    hhflvdlqpfgqdnpnevfyaadrpyglieatiqregsradhpiwsn
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vayC (C:)
    tkvvlgqnqygkaevrlvkvtrntarheiqdlnvtsqlrgdfeaahtagdnahvvatdtq
    kntvyafardgfatteefllrlgkhftegfdwvtggrwaaqqffwdrindhdhafsrnks
    evrtavleisgseqaivagiegltvlkstgsefhgfprdkyttlqettdrilatdvsarw
    ryntvevdfdavyasvrglllkafaethslalqqtmyemgraviethpeideikmslpnk
    hhflvdlqpfgqdnpnevfyaadrpyglieatiqregsradhpiwsn
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vayD (D:)
    tkvvlgqnqygkaevrlvkvtrntarheiqdlnvtsqlrgdfeaahtagdnahvvatdtq
    kntvyafardgfatteefllrlgkhftegfdwvtggrwaaqqffwdrindhdhafsrnks
    evrtavleisgseqaivagiegltvlkstgsefhgfprdkyttlqettdrilatdvsarw
    ryntvevdfdavyasvrglllkafaethslalqqtmyemgraviethpeideikmslpnk
    hhflvdlqpfgqdnpnevfyaadrpyglieatiqregsradhpiwsn
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vayE (E:)
    tkvvlgqnqygkaevrlvkvtrntarheiqdlnvtsqlrgdfeaahtagdnahvvatdtq
    kntvyafardgfatteefllrlgkhftegfdwvtggrwaaqqffwdrindhdhafsrnks
    evrtavleisgseqaivagiegltvlkstgsefhgfprdkyttlqettdrilatdvsarw
    ryntvevdfdavyasvrglllkafaethslalqqtmyemgraviethpeideikmslpnk
    hhflvdlqpfgqdnpnevfyaadrpyglieatiqregsradhpiwsn
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vayF (F:)
    tkvvlgqnqygkaevrlvkvtrntarheiqdlnvtsqlrgdfeaahtagdnahvvatdtq
    kntvyafardgfatteefllrlgkhftegfdwvtggrwaaqqffwdrindhdhafsrnks
    evrtavleisgseqaivagiegltvlkstgsefhgfprdkyttlqettdrilatdvsarw
    ryntvevdfdavyasvrglllkafaethslalqqtmyemgraviethpeideikmslpnk
    hhflvdlqpfgqdnpnevfyaadrpyglieatiqregsradhpiwsn
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vayG (G:)
    tkvvlgqnqygkaevrlvkvtrntarheiqdlnvtsqlrgdfeaahtagdnahvvatdtq
    kntvyafardgfatteefllrlgkhftegfdwvtggrwaaqqffwdrindhdhafsrnks
    evrtavleisgseqaivagiegltvlkstgsefhgfprdkyttlqettdrilatdvsarw
    ryntvevdfdavyasvrglllkafaethslalqqtmyemgraviethpeideikmslpnk
    hhflvdlqpfgqdnpnevfyaadrpyglieatiqregsradhpiwsn
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vayH (H:)
    tkvvlgqnqygkaevrlvkvtrntarheiqdlnvtsqlrgdfeaahtagdnahvvatdtq
    kntvyafardgfatteefllrlgkhftegfdwvtggrwaaqqffwdrindhdhafsrnks
    evrtavleisgseqaivagiegltvlkstgsefhgfprdkyttlqettdrilatdvsarw
    ryntvevdfdavyasvrglllkafaethslalqqtmyemgraviethpeideikmslpnk
    hhflvdlqpfgqdnpnevfyaadrpyglieatiqregsradhpiwsn