PDB entry 1vax

View 1vax on RCSB PDB site
Description: Crystal Structure of Uricase from Arthrobacter globiformis
Class: Oxidoreductase
Keywords: Oxidoreductase
Deposited on 2004-02-19, released 2005-06-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.99 Å
R-factor: 0.193
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uric acid oxidase
    Species: Arthrobacter globiformis [TaxId:1665]
    Database cross-references and differences (RAF-indexed):
    • PDB 1VAX (0-286)
    Domains in SCOPe 2.07: d1vaxa1, d1vaxa2
  • Chain 'B':
    Compound: Uric acid oxidase
    Species: Arthrobacter globiformis [TaxId:1665]
    Database cross-references and differences (RAF-indexed):
    • PDB 1VAX (0-286)
    Domains in SCOPe 2.07: d1vaxb1, d1vaxb2
  • Chain 'C':
    Compound: Uric acid oxidase
    Species: Arthrobacter globiformis [TaxId:1665]
    Database cross-references and differences (RAF-indexed):
    • PDB 1VAX (0-286)
    Domains in SCOPe 2.07: d1vaxc1, d1vaxc2
  • Chain 'D':
    Compound: Uric acid oxidase
    Species: Arthrobacter globiformis [TaxId:1665]
    Database cross-references and differences (RAF-indexed):
    • PDB 1VAX (0-286)
    Domains in SCOPe 2.07: d1vaxd1, d1vaxd2
  • Chain 'E':
    Compound: Uric acid oxidase
    Species: Arthrobacter globiformis [TaxId:1665]
    Database cross-references and differences (RAF-indexed):
    • PDB 1VAX (0-286)
    Domains in SCOPe 2.07: d1vaxe1, d1vaxe2
  • Chain 'F':
    Compound: Uric acid oxidase
    Species: Arthrobacter globiformis [TaxId:1665]
    Database cross-references and differences (RAF-indexed):
    • PDB 1VAX (0-286)
    Domains in SCOPe 2.07: d1vaxf1, d1vaxf2
  • Chain 'G':
    Compound: Uric acid oxidase
    Species: Arthrobacter globiformis [TaxId:1665]
    Database cross-references and differences (RAF-indexed):
    • PDB 1VAX (0-286)
    Domains in SCOPe 2.07: d1vaxg1, d1vaxg2
  • Chain 'H':
    Compound: Uric acid oxidase
    Species: Arthrobacter globiformis [TaxId:1665]
    Database cross-references and differences (RAF-indexed):
    • PDB 1VAX (0-286)
    Domains in SCOPe 2.07: d1vaxh1, d1vaxh2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vaxA (A:)
    tkvvlgqnqygkaevrlvkvtrntarheiqdlnvtsqlrgdfeaahtagdnahvvatdtq
    kntvyafardgfatteefllrlgkhftegfdwvtggrwaaqqffwdrindhdhafsrnks
    evrtavleisgseqaivagiegltvlkstgsefhgfprdkyttlqettdrilatdvsarw
    ryntvevdfdavyasvrglllkafaethslalqqtmyemgraviethpeideikmslpnk
    hhflvdlqpfgqdnpnevfyaadrpyglieatiqregsradhpiwsn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vaxB (B:)
    tkvvlgqnqygkaevrlvkvtrntarheiqdlnvtsqlrgdfeaahtagdnahvvatdtq
    kntvyafardgfatteefllrlgkhftegfdwvtggrwaaqqffwdrindhdhafsrnks
    evrtavleisgseqaivagiegltvlkstgsefhgfprdkyttlqettdrilatdvsarw
    ryntvevdfdavyasvrglllkafaethslalqqtmyemgraviethpeideikmslpnk
    hhflvdlqpfgqdnpnevfyaadrpyglieatiqregsradhpiwsn
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vaxC (C:)
    tkvvlgqnqygkaevrlvkvtrntarheiqdlnvtsqlrgdfeaahtagdnahvvatdtq
    kntvyafardgfatteefllrlgkhftegfdwvtggrwaaqqffwdrindhdhafsrnks
    evrtavleisgseqaivagiegltvlkstgsefhgfprdkyttlqettdrilatdvsarw
    ryntvevdfdavyasvrglllkafaethslalqqtmyemgraviethpeideikmslpnk
    hhflvdlqpfgqdnpnevfyaadrpyglieatiqregsradhpiwsn
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vaxD (D:)
    tkvvlgqnqygkaevrlvkvtrntarheiqdlnvtsqlrgdfeaahtagdnahvvatdtq
    kntvyafardgfatteefllrlgkhftegfdwvtggrwaaqqffwdrindhdhafsrnks
    evrtavleisgseqaivagiegltvlkstgsefhgfprdkyttlqettdrilatdvsarw
    ryntvevdfdavyasvrglllkafaethslalqqtmyemgraviethpeideikmslpnk
    hhflvdlqpfgqdnpnevfyaadrpyglieatiqregsradhpiwsn
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vaxE (E:)
    tkvvlgqnqygkaevrlvkvtrntarheiqdlnvtsqlrgdfeaahtagdnahvvatdtq
    kntvyafardgfatteefllrlgkhftegfdwvtggrwaaqqffwdrindhdhafsrnks
    evrtavleisgseqaivagiegltvlkstgsefhgfprdkyttlqettdrilatdvsarw
    ryntvevdfdavyasvrglllkafaethslalqqtmyemgraviethpeideikmslpnk
    hhflvdlqpfgqdnpnevfyaadrpyglieatiqregsradhpiwsn
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vaxF (F:)
    tkvvlgqnqygkaevrlvkvtrntarheiqdlnvtsqlrgdfeaahtagdnahvvatdtq
    kntvyafardgfatteefllrlgkhftegfdwvtggrwaaqqffwdrindhdhafsrnks
    evrtavleisgseqaivagiegltvlkstgsefhgfprdkyttlqettdrilatdvsarw
    ryntvevdfdavyasvrglllkafaethslalqqtmyemgraviethpeideikmslpnk
    hhflvdlqpfgqdnpnevfyaadrpyglieatiqregsradhpiwsn
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vaxG (G:)
    tkvvlgqnqygkaevrlvkvtrntarheiqdlnvtsqlrgdfeaahtagdnahvvatdtq
    kntvyafardgfatteefllrlgkhftegfdwvtggrwaaqqffwdrindhdhafsrnks
    evrtavleisgseqaivagiegltvlkstgsefhgfprdkyttlqettdrilatdvsarw
    ryntvevdfdavyasvrglllkafaethslalqqtmyemgraviethpeideikmslpnk
    hhflvdlqpfgqdnpnevfyaadrpyglieatiqregsradhpiwsn
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vaxH (H:)
    tkvvlgqnqygkaevrlvkvtrntarheiqdlnvtsqlrgdfeaahtagdnahvvatdtq
    kntvyafardgfatteefllrlgkhftegfdwvtggrwaaqqffwdrindhdhafsrnks
    evrtavleisgseqaivagiegltvlkstgsefhgfprdkyttlqettdrilatdvsarw
    ryntvevdfdavyasvrglllkafaethslalqqtmyemgraviethpeideikmslpnk
    hhflvdlqpfgqdnpnevfyaadrpyglieatiqregsradhpiwsn