PDB entry 1vav

View 1vav on RCSB PDB site
Description: Crystal structure of alginate lyase PA1167 from Pseudomonas aeruginosa at 2.0 A resolution
Class: lyase
Keywords: beta-sandwich, STRUCTURAL GENOMICS, LYASE
Deposited on 2004-02-19, released 2004-05-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.187
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alginate lyase PA1167
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Database cross-references and differences (RAF-indexed):
    • GB NP_249858 (0-221)
    Domains in SCOPe 2.08: d1vava_
  • Chain 'B':
    Compound: Alginate lyase PA1167
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Database cross-references and differences (RAF-indexed):
    • GB NP_249858 (0-221)
    Domains in SCOPe 2.08: d1vavb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vavA (A:)
    pdlstwnltipqgrpaitistsqlqrdyrsdyfqrtadgirfwvpvngshtrnsefprse
    lretlssgrpynwryaradnwleatlrieavpstrrmiigqihsdgsnsgqaaplvklly
    qlrldqgrvqalvrerpddggtraytlmdgiplgqpfsyrigvsrsgllsvsvngsaleq
    qldpqwayqglyfkaglylqdnrgpsseggratfselrvshq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vavB (B:)
    pdlstwnltipqgrpaitistsqlqrdyrsdyfqrtadgirfwvpvngshtrnsefprse
    lretlssgrpynwryaradnwleatlrieavpstrrmiigqihsdgsnsgqaaplvklly
    qlrldqgrvqalvrerpddggtraytlmdgiplgqpfsyrigvsrsgllsvsvngsaleq
    qldpqwayqglyfkaglylqdnrgpsseggratfselrvshq