PDB entry 1vas

View 1vas on RCSB PDB site
Description: atomic model of a pyrimidine dimer specific excision repair enzyme complexed with a dna substrate: structural basis for damaged dna recognition
Deposited on 1995-09-08, released 1995-09-08
The last revision prior to the SCOP 1.55 freeze date was dated 1996-01-29, with a file datestamp of 1996-01-31.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: 0.152
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.55: d1vasa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1vasA (A:)
  trinltlvseladqhlmaeyrqlprvfgavrkhvangkrvrdfkisptfilgaghvtffy
  dkleflrkrqieliaeclkrgfnikdttvqdisdipqefrgdyipheasiaisqarldek
  iaqrptwykyygkaiya