PDB entry 1vas

View 1vas on RCSB PDB site
Description: atomic model of a pyrimidine dimer specific excision repair enzyme complexed with a DNA substrate: structural basis for damaged DNA recognition
Class: hydrolase/DNA
Keywords: protein-DNA complex, double helix, hydrolase-DNA complex
Deposited on 1995-09-08, released 1995-09-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-05-01, with a file datestamp of 2013-04-26.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: 0.152
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (t4 endonuclease v (e.c.3.1.25.1))
    Species: Enterobacteria phage T4 sensu lato [TaxId:10665]
    Gene: denV
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04418 (0-136)
      • engineered (21)
    Domains in SCOPe 2.07: d1vasa_
  • Chain 'B':
    Compound: DNA (5'-d(*ap*tp*cp*gp*cp*gp*tp*tp*gp*cp*gp*cp*t)-3')
  • Chain 'C':
    Compound: DNA (5'-d(*tp*ap*gp*cp*gp*cp*ap*ap*cp*gp*cp*gp*a)-3')
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vasA (A:)
    trinltlvseladqhlmaeyrqlprvfgavrkhvangkrvrdfkisptfilgaghvtffy
    dkleflrkrqieliaeclkrgfnikdttvqdisdipqefrgdyipheasiaisqarldek
    iaqrptwykyygkaiya
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.