PDB entry 1var

View 1var on RCSB PDB site
Description: mitochondrial manganese superoxide dismutase variant with ile 58 replaced by thr
Class: oxidoreductase
Keywords: oxidoreductase, manganese, mitochondrion, transit peptide, polymorphism
Deposited on 1996-01-04, released 1996-06-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: manganese superoxide dismutase
    Species: Homo sapiens [TaxId:9606]
    Gene: HUMAN KIDNEY SOD2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vara1, d1vara2
  • Chain 'B':
    Compound: manganese superoxide dismutase
    Species: Homo sapiens [TaxId:9606]
    Gene: HUMAN KIDNEY SOD2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1varb1, d1varb2
  • Heterogens: MN3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1varA (A:)
    khslpdlpydygalephinaqimqlhhskhhaayvnnlnvteekyqealakgdvtaqtal
    qpalkfnggghinhsifwtnlspngggepkgelleaikrdfgsfdkfkekltaasvgvqg
    sgwgwlgfnkerghlqiaacpnqdplqgttglipllgidvwehayylqyknvrpdylkai
    wnvinwenvterymackk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1varB (B:)
    khslpdlpydygalephinaqimqlhhskhhaayvnnlnvteekyqealakgdvtaqtal
    qpalkfnggghinhsifwtnlspngggepkgelleaikrdfgsfdkfkekltaasvgvqg
    sgwgwlgfnkerghlqiaacpnqdplqgttglipllgidvwehayylqyknvrpdylkai
    wnvinwenvterymackk