PDB entry 1vag

View 1vag on RCSB PDB site
Description: Neuronal nitric oxide synthase oxygenase domain complexed with the inhibitor AR-R17477
Class: oxidoreductase
Keywords: rat nnosoxy complex with ar-r17477, oxidoreductase
Deposited on 2004-02-16, released 2004-06-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nitric-oxide synthase, brain
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Nos1, Bnos
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29476 (1-419)
      • cloning artifact (0)
    Domains in SCOPe 2.07: d1vaga1, d1vaga2
  • Heterogens: ZN, HEM, H4B, ARR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vagA (A:)
    gprflkvknwetdvvltdtlhlkstletgctehicmgsimlpsqhtrkpedvrtkdqlfp
    lakefldqyyssikrfgskahmdrleevnkeieststyqlkdteliygakhawrnasrcv
    griqwsklqvfdardcttahgmfnyicnhvkyatnkgnlrsaitifpqrtdgkhdfrvwn
    sqliryagykqpdgstlgdpanvqfteiciqqgwkaprgrfdvlplllqangndpelfqi
    ppelvlevpirhpkfdwfkdlglkwyglpavsnmlleigglefsacpfsgwymgteigvr
    dycdnsrynileevakkmdldmrktsslwkdqalveiniavlysfqsdkvtivdhhsate
    sfikhmeneyrcrggcpadwvwivppmsgsitpvfhqemlnyrltpsfeyqpdpwnthvw