PDB entry 1vaf

View 1vaf on RCSB PDB site
Description: Inducible nitric oxide synthase oxygenase domain complexed with the inhibitor AR-R17477
Class: oxidoreductase
Keywords: murine inosoxy inhibitor complex, oxidoreductase
Deposited on 2004-02-16, released 2004-06-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nitric oxide synthase, inducible
    Species: Mus musculus [TaxId:10090]
    Gene: Nos2, Inosl
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1vafa_
  • Chain 'B':
    Compound: Nitric oxide synthase, inducible
    Species: Mus musculus [TaxId:10090]
    Gene: Nos2, Inosl
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1vafb_
  • Heterogens: ZN, HEM, H4B, ARR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vafA (A:)
    qyvriknwgsgeilhdtlhhkatsdftcksksclgsimnpksltrgprdkptpleellph
    aiefinqyygsfkeakieehlarleavtkeiettgtyqltldelifatkmawrnaprcig
    riqwsnlqvfdarncstaqemfqhicrhilyatnngnirsaitvfpqrsdgkhdfrlwns
    qliryagyqmpdgtirgdaatleftqlcidlgwkprygrfdvlplvlqadgqdpevfeip
    pdlvlevtmehpkyewfqelglkwyalpavanmllevgglefpacpfngwymgteigvrd
    fcdtqrynileevgrrmglethtlaslwkdravteinvavlhsfqkqnvtimdhhtases
    fmkhmqneyrarggcpadwiwlvppvsgsitpvfhqemlnyvlspfyyyqiepwkthiw
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vafB (B:)
    qyvriknwgsgeilhdtlhhkatsdftcksksclgsimnpksltrgprdkptpleellph
    aiefinqyygsfkeakieehlarleavtkeiettgtyqltldelifatkmawrnaprcig
    riqwsnlqvfdarncstaqemfqhicrhilyatnngnirsaitvfpqrsdgkhdfrlwns
    qliryagyqmpdgtirgdaatleftqlcidlgwkprygrfdvlplvlqadgqdpevfeip
    pdlvlevtmehpkyewfqelglkwyalpavanmllevgglefpacpfngwymgteigvrd
    fcdtqrynileevgrrmglethtlaslwkdravteinvavlhsfqkqnvtimdhhtases
    fmkhmqneyrarggcpadwiwlvppvsgsitpvfhqemlnyvlspfyyyqiepwkthiw