PDB entry 1vae

View 1vae on RCSB PDB site
Description: Solution structure of the PDZ domain of mouse Rhophilin-2
Class: signaling protein
Keywords: PDZ domain, intracellular signaling cascade, signal transduction, Rho GTPase binding protein 2, alpha-actin-4 binding domain, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SIGNALING PROTEIN
Deposited on 2004-02-14, released 2004-08-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rhophilin, Rho GTPase binding protein 2
    Species: Mus musculus [TaxId:10090]
    Gene: RIKEN cDNA 1300002E07
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8BWR8 (7-104)
      • cloning artifact (0-6)
      • engineered (19)
      • cloning artifact (105-110)
    Domains in SCOPe 2.07: d1vaea1, d1vaea2, d1vaea3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vaeA (A:)
    gssgssgsaskrwspprgihftveegdlgftlrgntpvqvhfldphcsaslagakegdyi
    vsiqgvdckwltvsevmkllksfggeevemkvvslldstssmhnksgpssg