PDB entry 1vad

View 1vad on RCSB PDB site
Description: MHC class I h-2kb heavy chain complexed with beta-2 microglobulin and yeast alpha-glucosidase
Class: complex (MHC I/peptide)
Keywords: histocompatibility antigen, class I major histocompatibility complex, MHC I, peptide
Deposited on 1994-11-01, released 1996-06-20
The last revision prior to the SCOP 1.73 freeze date was dated 1996-06-20, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.16
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MHC class I h-2kb heavy chain
    Species: MUS MUSCULUS
    Gene: BETA-2-MICROGLOBULIN
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1vada1, d1vada2
  • Chain 'B':
    Compound: beta-2 microglobulin
    Species: MUS MUSCULUS
    Gene: BETA-2-MICROGLOBULIN
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1vadb_
  • Chain 'P':
    Compound: yeast alpha-glucosidase
    Species: SACCHAROMYCES CEREVISIAE
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vadA (A:)
    gphslryfvtavsrpglgeprymevgyvddtefvrfdsdaenpryeprarwmeqegpeyw
    eretqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyaydg
    cdyialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatll
    rtdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgt
    fqkwasvvvplgkeqyytchvyhqglpepltlrw
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vadB (B:)
    iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
    sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
    

  • Chain 'P':
    No sequence available.