PDB entry 1va9

View 1va9 on RCSB PDB site
Description: Solution structure of the second FNIII domain of DSCAML1 protein
Class: cell adhesion
Keywords: FNIII domain, DSCAML1 protein, Structural Genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, CELL ADHESION
Deposited on 2004-02-13, released 2005-02-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Down syndrome cell adhesion molecule like-protein 1b
    Species: Homo sapiens [TaxId:9606]
    Gene: Kazusa cDNA KIAA1132
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8TD84 (7-115)
      • cloning artifact (0-6)
      • cloning artifact (116-121)
    Domains in SCOPe 2.08: d1va9a1, d1va9a2, d1va9a3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1va9A (A:)
    gssgssgisteeaapdgppmdvtlqpvtsqsiqvtwkapkkelqngvirgyqigyrensp
    gsngqysivemkatgdsevytldnlkkfaqygvvvqafnragtgpssseinattlesgps
    sg