PDB entry 1va8

View 1va8 on RCSB PDB site
Description: Solution structure of the PDZ domain of Pals1 protein
Class: membrane protein
Keywords: PDZ domain, palmitoylated 5, Pals1 protein, Structural Genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, MEMBRANE PROTEIN
Deposited on 2004-02-13, released 2005-02-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MAGUK p55 subfamily member 5
    Species: Mus musculus [TaxId:10090]
    Gene: RIKEN cDNA 3830420B02
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9JLB2 (7-106)
      • cloning artifact (0-6)
      • cloning artifact (107-112)
    Domains in SCOPe 2.07: d1va8a1, d1va8a2, d1va8a3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1va8A (A:)
    gssgssgpitdervyesighyggetvkivriekardiplgatvrnemdsviisrivkgga
    aeksgllhegdevleingieirgkdvnevfdllsdmhgtltfvlipssgpssg