PDB entry 1va6

View 1va6 on RCSB PDB site
Description: Crystal structure of Gamma-glutamylcysteine synthetase from Escherichia Coli B complexed with Transition-state analogue
Class: ligase
Keywords: Glutathione homeostasis, Beta barrel, Peptide synthesis, Transition state analogue, LIGASE
Deposited on 2004-02-12, released 2004-10-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.2
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutamate--cysteine ligase
    Species: Escherichia coli [TaxId:562]
    Gene: GSH-I
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6W9 (0-End)
      • engineered (105)
      • engineered (163)
      • engineered (204)
      • engineered (222)
    Domains in SCOPe 2.07: d1va6a_
  • Chain 'B':
    Compound: Glutamate--cysteine ligase
    Species: Escherichia coli [TaxId:562]
    Gene: GSH-I
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6W9 (0-End)
      • engineered (105)
      • engineered (163)
      • engineered (204)
      • engineered (222)
    Domains in SCOPe 2.07: d1va6b_
  • Heterogens: MG, P2S, ADP, P6G, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1va6A (A:)
    mipdvsqalawlekhpqalkgiqrgleretlrvnadgtlattghpealgsalthkwittd
    faeallefitpvdgdiehmltfmrdlhrytarnmgdermwplsmpsyiaegqdielaqyg
    tsntgrfktlyreglknrygalmqtisgvhynfslpmafwqaksgdisgadakekisagy
    frvirnyyrfgwvipylfgaspaisssflqgkptslpfektesgmyylpyatslrlsdlg
    ytnksqsnlgitfndlyeyvaglkqaiktpseeyakigiekdgkrlqinsnvlqienely
    apirpkrvtrsgespsdallrggieyievrsldinpfspigvdeqqvrfldlfmvwcala
    dapemssselactrvnwnrvilegrkpgltlgigcetaqfplpqvgkdlfrdlkrvaqtl
    dsinggeayqkvcdelvacfdnpdltfsarilrsmidtgiggtgkafaeayrnllreepl
    eilreedfvaereaserrqqemeaadtepfavwlekha
    

    Sequence, based on observed residues (ATOM records): (download)
    >1va6A (A:)
    mipdvsqalawlekhpqalkgiqrgleretlrvnadgtlattghpealgsalthkwittd
    faeallefitpvdgdiehmltfmrdlhrytarnmgdermwplsmpsyiaegqdielaqyg
    tsntgrfktlyreglknrygalmqtisgvhynfslpmafwqaksgdisgadakekisagy
    frvirnyyrfgwvipylfgaspaisssfltslpfektesgmyylpyatslrlsdlgytnk
    sqsnlgitfndlyeyvaglkqaiktpseeyakigiekdgkrlqinsnvlqienelyapir
    pkrvtrsgespsdallrggieyievrsldinpfspigvdeqqvrfldlfmvwcaladape
    mssselactrvnwnrvilegrkpgltlgigcetaqfplpqvgkdlfrdlkrvaqtldsin
    ggeayqkvcdelvacfdnpdltfsarilrsmidttgkafaeayrnllreepleilreedf
    vaereaserrqqemeaadtepfavwle
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1va6B (B:)
    mipdvsqalawlekhpqalkgiqrgleretlrvnadgtlattghpealgsalthkwittd
    faeallefitpvdgdiehmltfmrdlhrytarnmgdermwplsmpsyiaegqdielaqyg
    tsntgrfktlyreglknrygalmqtisgvhynfslpmafwqaksgdisgadakekisagy
    frvirnyyrfgwvipylfgaspaisssflqgkptslpfektesgmyylpyatslrlsdlg
    ytnksqsnlgitfndlyeyvaglkqaiktpseeyakigiekdgkrlqinsnvlqienely
    apirpkrvtrsgespsdallrggieyievrsldinpfspigvdeqqvrfldlfmvwcala
    dapemssselactrvnwnrvilegrkpgltlgigcetaqfplpqvgkdlfrdlkrvaqtl
    dsinggeayqkvcdelvacfdnpdltfsarilrsmidtgiggtgkafaeayrnllreepl
    eilreedfvaereaserrqqemeaadtepfavwlekha
    

    Sequence, based on observed residues (ATOM records): (download)
    >1va6B (B:)
    mipdvsqalawlekhpqalkgiqrgleretlrvnadgtlattghpealgsalthkwittd
    faeallefitpvdgdiehmltfmrdlhrytarnmgdermwplsmpsyiaegqdielaqyg
    tsntgrfktlyreglknrygalmqtisgvhynfslpmafwqaksgadakekisagyfrvi
    rnyyrfgwvipylfgaspaisssfltslpfektesgmyylpyatslrlsdlgytnksqsn
    lgitfndlyeyvaglkqaiktpseeyakigiekdgkrlqinsnvlqienelyapirpkrv
    trsgespsdallrggieyievrsldinpfspigvdeqqvrfldlfmvwcaladapemsss
    elactrvnwnrvilegrkpgltlgigcetaqfplpqvgkdlfrdlkrvaqtldsinggea
    yqkvcdelvacfdnpdltfsarilrsmidttgkafaeayrnllreepleilreedfvaer
    easerrqqemeaadtepfavwle