PDB entry 1va2

View 1va2 on RCSB PDB site
Description: Solution Structure of Transcription Factor Sp1 DNA Binding Domain (Zinc Finger 2)
Class: transcription
Keywords: C2H2 type Zinc finger, Transcription Factor, DNA-Binding Protein
Deposited on 2004-02-07, released 2005-02-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcription factor Sp1
    Species: Homo sapiens [TaxId:9606]
    Gene: SP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1va2a_
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1va2A (A:)
    rpfmctwsycgkrftrsdelqrhkrthtgek