PDB entry 1va1

View 1va1 on RCSB PDB site
Description: Solution Structure of Transcription Factor Sp1 DNA Binding Domain (Zinc Finger 1)
Deposited on 2004-02-07, released 2005-02-08
The last revision was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcription factor Sp1
    Species: Homo sapiens [TaxId:9606]
    Gene: SP1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08047 (1-36)
      • initiating methionine (0)
  • Heterogens: ZN

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1va1A (A:)
    mdpgkkkqhichiqgcgkvygktshlrahlrwhtger