PDB entry 1va0

View 1va0 on RCSB PDB site
Description: Crystal Structure of the Native Form of Uroporphyrin III C-methyl transferase from Thermus thermophilus
Class: transferase
Keywords: transferase, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2004-02-05, released 2005-02-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-09-28, with a file datestamp of 2016-09-23.
Experiment type: XRAY
Resolution: 1.97 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uroporphyrin-III C-methyltransferase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
    • GB YP_143933 (0-End)
    Domains in SCOPe 2.07: d1va0a_
  • Chain 'B':
    Compound: Uroporphyrin-III C-methyltransferase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
    • GB YP_143933 (0-End)
    Domains in SCOPe 2.07: d1va0b_
  • Heterogens: CL, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1va0A (A:)
    grvylvgagpgdpelltlkayrllkeapvvlydrlvdervlalapgekvyvgkeegesek
    qeeihrlllrharahpfvvrlkggdpmvfgrggeevlfllrhgvpvevvpgvtsllasgl
    plthrglahgfaavsgvlegggypdlrpfarvptlvvlmgvgrrvwiakellrlgrdpre
    ptlfverastpkerrvharleevaegkvevrppalwilgevvrvfaekeapvdalalgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1va0A (A:)
    grvylvgagpgdpelltlkayrllkeapvvlydrlvdervlalapgekvyvgkeekqeei
    hrlllrharahpfvvrlkggdpmvfgrggeevlfllrhgvpvevvpgvtsllasglplth
    rglahgfaavsgvlegggypdlrpfarvptlvvlmgvgrrvwiakellrlgrdpreptlf
    verastpkerrvharleevaegkvevrppalwilgevvrvf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1va0B (B:)
    grvylvgagpgdpelltlkayrllkeapvvlydrlvdervlalapgekvyvgkeegesek
    qeeihrlllrharahpfvvrlkggdpmvfgrggeevlfllrhgvpvevvpgvtsllasgl
    plthrglahgfaavsgvlegggypdlrpfarvptlvvlmgvgrrvwiakellrlgrdpre
    ptlfverastpkerrvharleevaegkvevrppalwilgevvrvfaekeapvdalalgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1va0B (B:)
    grvylvgagpgdpelltlkayrllkeapvvlydrlvdervlalapgekvyveeihrlllr
    harahpfvvrlkggdpmvfgrggeevlfllrhgvpvevvpgvtsllasglplthrglahg
    faavsgvlegggypdlrpfarvptlvvlmgvgrrvwiakellrlgrdpreptlfverast
    pkerrvharleevaegkvevrppalwilgevvrvfaekeapvdalal