PDB entry 1v9z

View 1v9z on RCSB PDB site
Description: Crystal Structure of the heme PAS sensor domain of Ec DOS (Ferrous Form)
Deposited on 2004-02-04, released 2004-05-25
The last revision prior to the SCOP 1.69 freeze date was dated 2004-05-25, with a file datestamp of 2004-05-25.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.244
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1v9za_
  • Chain 'B':
    Domains in SCOP 1.69: d1v9zb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1v9zA (A:)
    mgsshhhhhhssglvprgshmrqdaevimkltdadnaadgiffpaleqnmmgavlinend
    evmffnpaaeklwgykreevignnidmliprdlrpahpeyirhnreggkarvegmsrelq
    lekkdgskiwtrfalskvsaegkvyylalvrdasvemaqkeqtrqli
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v9zA (A:)
    giffpaleqnmmgavlinendevmffnpaaeklwgykreevignnidmliprdlrpahpe
    yirhnreggkarvegmsrelqlekkdgskiwtrfalskvsaegkvyylalvrd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1v9zB (B:)
    mgsshhhhhhssglvprgshmrqdaevimkltdadnaadgiffpaleqnmmgavlinend
    evmffnpaaeklwgykreevignnidmliprdlrpahpeyirhnreggkarvegmsrelq
    lekkdgskiwtrfalskvsaegkvyylalvrdasvemaqkeqtrqli
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v9zB (B:)
    giffpaleqnmmgavlinendevmffnpaaeklwgykreevignnidmliprdlrpahpe
    yirhnreggkarvegmsrelqlekkdgskiwtrfalskvsaegkvyylalvrd