PDB entry 1v9y

View 1v9y on RCSB PDB site
Description: Crystal Structure of the heme PAS sensor domain of Ec DOS (ferric form)
Class: signaling protein
Keywords: heme, pas, sensor, signaling protein
Deposited on 2004-02-04, released 2004-05-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.32 Å
R-factor: 0.163
AEROSPACI score: 0.75 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Heme pas sensor protein
    Species: Escherichia coli [TaxId:83333]
    Gene: DOS
    Database cross-references and differences (RAF-indexed):
    • GB NP_416006
    Domains in SCOPe 2.08: d1v9ya_
  • Chain 'B':
    Compound: Heme pas sensor protein
    Species: Escherichia coli [TaxId:83333]
    Gene: DOS
    Database cross-references and differences (RAF-indexed):
    • GB NP_416006
    Domains in SCOPe 2.08: d1v9yb_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1v9yA (A:)
    mgsshhhhhhssglvprgshmrqdaevimkltdadnaadgiffpaleqnmmgavlinend
    evmffnpaaeklwgykreevignnidmliprdlrpahpeyirhnreggkarvegmsrelq
    lekkdgskiwtrfalskvsaegkvyylalvrdasvemaqkeqtrqli
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v9yA (A:)
    giffpaleqnmmgavlinendevmffnpaaeklwgykreevignnidmliprdlrpahpe
    yirhnrerelqlekkdgskiwtrfalskvsaegkvyylalvrd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1v9yB (B:)
    mgsshhhhhhssglvprgshmrqdaevimkltdadnaadgiffpaleqnmmgavlinend
    evmffnpaaeklwgykreevignnidmliprdlrpahpeyirhnreggkarvegmsrelq
    lekkdgskiwtrfalskvsaegkvyylalvrdasvemaqkeqtrqli
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v9yB (B:)
    giffpaleqnmmgavlinendevmffnpaaeklwgykreevignnidmliprdlrpahpe
    yirhnrerelqlekkdgskiwtrfalskvsaegkvyylalvrd