PDB entry 1v9x

View 1v9x on RCSB PDB site
Description: Solution structure of the first Zn-finger domain of poly(ADP-ribose) polymerase-1
Deposited on 2004-02-04, released 2005-02-22
The last revision was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: poly (ADP-ribose) polymerase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: RIKEN cDNA RAFL09-59-L22
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ZP54 (7-107)
      • cloning artifact (0-6)
      • cloning artifact (108-113)
  • Heterogens: ZN

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1v9xA (A:)
    gssgssghkpwraeyakssrsscktcksvinkenfrlgklvqsthfdgimpmwnhascil
    kktkqiksvddvegieslrwedqqkirkyvesgagsntststgtstsssgpssg