PDB entry 1v9w

View 1v9w on RCSB PDB site
Description: Solution structure of mouse putative 42-9-9 protein
Class: Structural genomics, unknown function
Keywords: Thioredoxin-like fold, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, unknown function
Deposited on 2004-02-03, released 2004-08-03
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative 42-9-9 protein
    Species: Mus musculus [TaxId:10090]
    Gene: RIKEN cDNA 1110050H17
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9D0Y4 (7-129)
      • cloning artifact (0-6)
    Domains in SCOPe 2.01: d1v9wa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v9wA (A:)
    gsegaatmatfeevsvlgfeefdkavkehesktifayfsgskdtegkswcpdcveaepvi
    reglkhvtedcvfiycqvgdkpywkdpnndfrqklkitavptllkygtpqklveseccqs
    slvemifsed