PDB entry 1v9v

View 1v9v on RCSB PDB site
Description: Solution structure of putative domain of human KIAA0561 protein
Class: structural genomics, unknown function
Keywords: 4 helix bundle, MAST205, microtubule-associated serine/threonine protein kinase, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION
Deposited on 2004-02-03, released 2005-03-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: KIAA0561 protein
  Species: Homo sapiens [TaxId:9606]
  Gene: KAZUSA cDNA hh01676
  Database cross-references and differences (RAF-indexed):
  • Uniprot O60307 (7-107)
    • cloning artifact (0-6)
    • cloning artifact (108-113)
  Domains in SCOPe 2.08: d1v9va1, d1v9va2, d1v9va3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1v9vA (A:)
  gssgssgpkataqmegrlqefltayapgarlaladgvlgfihhqivelardclaksgenl
  vtsryflemqeklerllqdahersdseevsfivqlvrklliiisrparsgpssg