PDB entry 1v9u

View 1v9u on RCSB PDB site
Description: Human Rhinovirus 2 bound to a fragment of its cellular receptor protein
Deposited on 2004-02-03, released 2004-05-04
The last revision prior to the SCOP 1.67 freeze date was dated 2004-05-04, with a file datestamp of 2004-05-04.
Experiment type: XRAY
Resolution: 3.6 Å
R-factor: 0.285
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '1':
    Domains in SCOP 1.67: d1v9u1_
  • Chain '2':
    Domains in SCOP 1.67: d1v9u.1
  • Chain '3':
    Domains in SCOP 1.67: d1v9u3_
  • Chain '4':
    Domains in SCOP 1.67: d1v9u.1
  • Chain '5':
    Domains in SCOP 1.67: d1v9u5_

PDB Chain Sequences:

  • Chain '1':
    Sequence, based on SEQRES records: (download)
    >1v9u1 (1:)
    npvenyidevlnevlvvpninssnpttsnsapaldaaetghtssvqpedvietryvqtsq
    trdemslesflgrsgcihesklevtlanynkenftvwainlqemaqirrkfelftytrfd
    seitlvpcisalsqdighitmqymyvppgapvpnsrddyawqsgtnasvfwqhgqayprf
    slpflsvasayymfydgydeqdqnygtantnnmgslcsrivtekhihkvhimtriyhkak
    hvkawcprppraleytrahrtnfkiedrsiqtaivtrpiittagpsdmy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v9u1 (1:)
    lvvpninssnpttsnsapaldaaetghtssvqpedvietryvqtsqtrdemslesflgrs
    gcihesklevtlanynkenftvwainlqemaqirrkfelftytrfdseitlvpcisalsq
    dighitmqymyvppgapvpnsrddyawqsgtnasvfwqhgqayprfslpflsvasayymf
    ydgydeqdqnygtantnnmgslcsrivtekhihkvhimtriyhkakhvkawcprpprale
    ytrahrtnfkiedrsiqtaivtrpiitta
    

  • Chain '2':
    Sequence, based on SEQRES records: (download)
    >1v9u2 (2:)
    sptveacgysdriiqitrgdstitsqdvanaivaygvwphylsskdasaidkpsqpdtss
    nrfytlrsvtwsssskgwwwklpdalkdmgifgenmfyhylgrsgytihvqcnaskfhqg
    tlivalipehqiasalhgnvnvgynythpgetgrevkaetrlnpdlqpteeywlnfdgtl
    lgnitifphqfinlrsnnsatiiapyvnavpmdsmrshnnwslviipicpletssainti
    pitisispmcaefsgarakrq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v9u2 (2:)
    riiqitrgdstitsqdvanaivaygvwphylsskdasaidkpsqpdtssnrfytlrsvtw
    sssskgwwwklpdalkdmgifgenmfyhylgrsgytihvqcnaskfhqgtlivalipehq
    iasalhgnvnvgynythpgetgrevkaetrlnpdlqpteeywlnfdgtllgnitifphqf
    inlrsnnsatiiapyvnavpmdsmrshnnwslviipicpletssaintipitisispmca
    efsgarakrq
    

  • Chain '3':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v9u3 (3:)
    glpvfitpgsgqflttddfqspcalpwyhptkeisipgevknlveicqvdslvpinntdt
    yinsenmysvvlqssinapdkifsirtdvasqplattligeissyfthwtgslrfsfmfc
    gtanttvklllaytppgiaepttrkdamlgthviwdvglqstismvvpwisashyrntsp
    grstsgyitcwyqtrlvippqtpptarllcfvsgckdfclrmardtnlhlqsgaiaq
    

  • Chain '4':
    Sequence, based on SEQRES records: (download)
    >1v9u4 (4:)
    gaqvsrqnvgthstqnsvsngsslnyfninyfkdaasngaskleftqdpskftdpvkdvl
    ekgiptlq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v9u4 (4:)
    aqvsrqnyfninyfkdaasngaskl
    

  • Chain '5':
    Sequence, based on SEQRES records: (download)
    >1v9u5 (5:)
    rtcriheiscgahstqcipvswrcdgendcdsgedeencgn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v9u5 (5:)
    criheiscgahstqcipvswrcdgendcdsgedeencgn