PDB entry 1v9t

View 1v9t on RCSB PDB site
Description: Structure of E. coli cyclophilin B K163T mutant bound to succinyl-ALA-PRO-ALA-P-nitroanilide
Class: isomerase/isomerase inhibitor
Keywords: BETA BARREL, ISOMERASE-ISOMERASE INHIBITOR complex
Deposited on 2004-02-03, released 2004-09-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-09-05, with a file datestamp of 2012-08-31.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.184
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cyclophilin B
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20752 (0-165)
      • conflict (162)
    Domains in SCOPe 2.07: d1v9ta_
  • Chain 'B':
    Compound: cyclophilin B
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20752 (0-165)
      • conflict (162)
    Domains in SCOPe 2.07: d1v9tb_
  • Chain 'C':
    Compound: (sin)apa(nit)
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1V9T (0-4)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v9tA (A:)
    akgdphvllttsagnieleldkqkapvsvqnfvdyvnsgfynnttfhrvipgfmiqgggf
    teqmqqkkpnppikneadnglrntrgtiamartadkdsatsqffinvadnafldhgqrdf
    gyavfgkvvkgmdvadkisqvpthdvgpyqnvpskpvvilsatvlp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v9tB (B:)
    akgdphvllttsagnieleldkqkapvsvqnfvdyvnsgfynnttfhrvipgfmiqgggf
    teqmqqkkpnppikneadnglrntrgtiamartadkdsatsqffinvadnafldhgqrdf
    gyavfgkvvkgmdvadkisqvpthdvgpyqnvpskpvvilsatvlp
    

  • Chain 'C':
    No sequence available.