PDB entry 1v9p

View 1v9p on RCSB PDB site
Description: Crystal Structure Of Nad+-Dependent DNA Ligase
Deposited on 2004-01-27, released 2004-03-30
The last revision prior to the SCOP 1.67 freeze date was dated 2004-03-30, with a file datestamp of 2004-03-30.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.232
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v9pA (A:)
    mtreearrrinelrdliryhnyryyvladpeisdaeydrllrelkeleerfpefkspdsp
    teqvgarpleptfrpvrhptrmysldnaftyeevlafeerleralgrkrpflytvehkvd
    glsvnlyyeegvlvfgatrgdgevgeevtqnlltiptiprrlkgvpdrlevrgevympie
    aflrlneeleergekvfknprnaaagslrqkdprvtakrglratfyalglgleesglksq
    yelllwlkekgfpvehgyekalgaegveevyrrflaqrhalpfeadgvvvklddlalwre
    lgytaraprfalaykfpaeeketrlldvvfqvgrtgrvtpvgvlepvfiegsevsrvtlh
    nesyieeldirigdwvlvhkaggvipevlrvlkerrtgeerpirwpetcpecghrlvkeg
    kvhrcpnplcpakrfeairhyasrkamdieglgeklierllekglvrdvadlyhlrkedl
    lglermgeksaqnllrqieeskhrglerllyalglpgvgevlarnlarrfgtmdrlleas
    leelleveevgeltarailetlkdpafrdlvrrlkeagvsmesk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v9pB (B:)
    mtreearrrinelrdliryhnyryyvladpeisdaeydrllrelkeleerfpefkspdsp
    teqvgarpleptfrpvrhptrmysldnaftyeevlafeerleralgrkrpflytvehkvd
    glsvnlyyeegvlvfgatrgdgevgeevtqnlltiptiprrlkgvpdrlevrgevympie
    aflrlneeleergekvfknprnaaagslrqkdprvtakrglratfyalglgleesglksq
    yelllwlkekgfpvehgyekalgaegveevyrrflaqrhalpfeadgvvvklddlalwre
    lgytaraprfalaykfpaeeketrlldvvfqvgrtgrvtpvgvlepvfiegsevsrvtlh
    nesyieeldirigdwvlvhkaggvipevlrvlkerrtgeerpirwpetcpecghrlvkeg
    kvhrcpnplcpakrfeairhyasrkamdieglgeklierllekglvrdvadlyhlrkedl
    lglermgeksaqnllrqieeskhrglerllyalglpgvgevlarnlarrfgtmdrlleas
    leelleveevgeltarailetlkdpafrdlvrrlkeagvsmesk