PDB entry 1v9p

View 1v9p on RCSB PDB site
Description: Crystal Structure Of Nad+-Dependent DNA Ligase
Class: ligase
Keywords: Nad+-Dependent DNA Ligase
Deposited on 2004-01-27, released 2004-03-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.232
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA ligase
    Species: Thermus filiformis [TaxId:276]
    Gene: ligA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1v9pa1, d1v9pa2, d1v9pa3
  • Chain 'B':
    Compound: DNA ligase
    Species: Thermus filiformis [TaxId:276]
    Gene: ligA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1v9pb1, d1v9pb2, d1v9pb3
  • Heterogens: ZN, AMP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v9pA (A:)
    mtreearrrinelrdliryhnyryyvladpeisdaeydrllrelkeleerfpefkspdsp
    teqvgarpleptfrpvrhptrmysldnaftyeevlafeerleralgrkrpflytvehkvd
    glsvnlyyeegvlvfgatrgdgevgeevtqnlltiptiprrlkgvpdrlevrgevympie
    aflrlneeleergekvfknprnaaagslrqkdprvtakrglratfyalglgleesglksq
    yelllwlkekgfpvehgyekalgaegveevyrrflaqrhalpfeadgvvvklddlalwre
    lgytaraprfalaykfpaeeketrlldvvfqvgrtgrvtpvgvlepvfiegsevsrvtlh
    nesyieeldirigdwvlvhkaggvipevlrvlkerrtgeerpirwpetcpecghrlvkeg
    kvhrcpnplcpakrfeairhyasrkamdieglgeklierllekglvrdvadlyhlrkedl
    lglermgeksaqnllrqieeskhrglerllyalglpgvgevlarnlarrfgtmdrlleas
    leelleveevgeltarailetlkdpafrdlvrrlkeagvsmesk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v9pB (B:)
    mtreearrrinelrdliryhnyryyvladpeisdaeydrllrelkeleerfpefkspdsp
    teqvgarpleptfrpvrhptrmysldnaftyeevlafeerleralgrkrpflytvehkvd
    glsvnlyyeegvlvfgatrgdgevgeevtqnlltiptiprrlkgvpdrlevrgevympie
    aflrlneeleergekvfknprnaaagslrqkdprvtakrglratfyalglgleesglksq
    yelllwlkekgfpvehgyekalgaegveevyrrflaqrhalpfeadgvvvklddlalwre
    lgytaraprfalaykfpaeeketrlldvvfqvgrtgrvtpvgvlepvfiegsevsrvtlh
    nesyieeldirigdwvlvhkaggvipevlrvlkerrtgeerpirwpetcpecghrlvkeg
    kvhrcpnplcpakrfeairhyasrkamdieglgeklierllekglvrdvadlyhlrkedl
    lglermgeksaqnllrqieeskhrglerllyalglpgvgevlarnlarrfgtmdrlleas
    leelleveevgeltarailetlkdpafrdlvrrlkeagvsmesk