PDB entry 1v9n

View 1v9n on RCSB PDB site
Description: Structure of Malate Dehydrogenase from Pyrococcus horikoshii OT3
Class: oxidoreductase
Keywords: Dehydrogenase, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, OXIDOREDUCTASE
Deposited on 2004-01-26, released 2005-03-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.208
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: malate dehydrogenase
    Species: Pyrococcus horikoshii [TaxId:70601]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O59028 (0-359)
      • modified residue (0)
      • modified residue (45)
      • modified residue (104)
      • modified residue (136)
      • modified residue (142)
      • modified residue (147)
      • modified residue (184)
      • modified residue (250)
      • modified residue (282)
      • modified residue (302)
      • modified residue (329)
    Domains in SCOPe 2.08: d1v9na_
  • Heterogens: NDP, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1v9nA (A:)
    mfekgyvdenyirvpkdrlfsfivrvltklgvpeedakivadnlvmadlrgveshgvqrl
    kryvdgiisggvnlhpkirviregpsyalidgdeglgqvvgyrsmklaikkakdtgigiv
    iarnsnhygiagyyalmaaeegmigismtnsrplvaptggierilgtnpialaaptkdkp
    flldmatsvvpigklevyrrkgkdipegwainregnittkveevfnggallplggfgell
    gghkgyglslmvdilsgilsggtwskyvkntsekgsnvchffmvidiehfipleefkeki
    sqmieeikssrkhpeferiwihgekgfltmetrlklgipiyrkvleelneiakrvgvegl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v9nA (A:)
    mfekgyvdenyirvpkdrlfsfivrvltklgvpeedakivadnlvmadlrgveshgvqrl
    kryvdgiisggvnlhpkirviregpsyalidgdeglgqvvgyrsmklaikkakdtgigiv
    iarnsnhygiagyyalmaaeegmigismtnsrplvaptggierilgtnpialaaptkdkp
    flldmatsvvpigklewainregnittkveevfnggallplggfgellgghkgyglslmv
    dilsgilsggtwskyvkntsekgsnvchffmvidiehfipleefkekisqmieeikssrk
    hpeferiwihgekgfltmetrlklgipiyrkvleelneiakrvgvegl