PDB entry 1v9l

View 1v9l on RCSB PDB site
Description: L-glutamate dehydrogenase from Pyrobaculum islandicum complexed with NAD
Class: oxidoreductase
Keywords: Protein-NAD complex, OXIDOREDUCTASE
Deposited on 2004-01-26, released 2004-12-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.2
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutamate dehydrogenase
    Species: Pyrobaculum islandicum [TaxId:2277]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1v9la1, d1v9la2
  • Chain 'B':
    Compound: glutamate dehydrogenase
    Species: Pyrobaculum islandicum [TaxId:2277]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1v9lb1, d1v9lb2
  • Chain 'C':
    Compound: glutamate dehydrogenase
    Species: Pyrobaculum islandicum [TaxId:2277]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1v9lc1, d1v9lc2
  • Chain 'D':
    Compound: glutamate dehydrogenase
    Species: Pyrobaculum islandicum [TaxId:2277]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1v9ld1, d1v9ld2
  • Chain 'E':
    Compound: glutamate dehydrogenase
    Species: Pyrobaculum islandicum [TaxId:2277]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1v9le1, d1v9le2
  • Chain 'F':
    Compound: glutamate dehydrogenase
    Species: Pyrobaculum islandicum [TaxId:2277]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1v9lf1, d1v9lf2
  • Heterogens: NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1v9lA (A:)
    mertgfleyvlnyvkkgvelggfpedfykilsrprrvlivnipvrldgggfevfegyrvq
    hcdvlgpykggvrfhpevtladdvalailmtlknslaglpyggakgavrvdpkklsqrel
    eelsrgyaraiapligdvvdipapdvgtnaqimawmvdeyskikgynvpgvftskppelw
    gnpvreyatgfgvavatremakklwggiegktvaiqgmgnvgrwtaywlekmgakviavs
    dingvayrkeglnveliqknkgltgpalvelfttkdnaefvknpdaifkldvdifvpaai
    envirgdnaglvkarlvvegangpttpeaerilyergvvvvpdilanaggvimsylewve
    nlqwyiwdeeetrkrlenimvnnvervykrwqrekgwtmrdaaivtaleriynamkirgw
    i
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v9lA (A:)
    tgfleyvlnyvkkgvelggfpedfykilsrprrvlivnipvrldgggfevfegyrvqhcd
    vlgpykggvrfhpevtladdvalailmtlknslaglpyggakgavrvdpkklsqreleel
    srgyaraiapligdvvdipapdvgtnaqimawmvdeyskikgynvpgvftskppelwgnp
    vreyatgfgvavatremakklwggiegktvaiqgmgnvgrwtaywlekmgakviavsdin
    gvayrkeglnveliqknkgltgpalvelfttkdnaefvknpdaifkldvdifvpaaienv
    irgdnaglvkarlvvegangpttpeaerilyergvvvvpdilanaggvimsylewvenlq
    wyiwdeeetrkrlenimvnnvervykrwqrekgwtmrdaaivtaleriynamkirgwi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1v9lB (B:)
    mertgfleyvlnyvkkgvelggfpedfykilsrprrvlivnipvrldgggfevfegyrvq
    hcdvlgpykggvrfhpevtladdvalailmtlknslaglpyggakgavrvdpkklsqrel
    eelsrgyaraiapligdvvdipapdvgtnaqimawmvdeyskikgynvpgvftskppelw
    gnpvreyatgfgvavatremakklwggiegktvaiqgmgnvgrwtaywlekmgakviavs
    dingvayrkeglnveliqknkgltgpalvelfttkdnaefvknpdaifkldvdifvpaai
    envirgdnaglvkarlvvegangpttpeaerilyergvvvvpdilanaggvimsylewve
    nlqwyiwdeeetrkrlenimvnnvervykrwqrekgwtmrdaaivtaleriynamkirgw
    i
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v9lB (B:)
    tgfleyvlnyvkkgvelggfpedfykilsrprrvlivnipvrldgggfevfegyrvqhcd
    vlgpykggvrfhpevtladdvalailmtlknslaglpyggakgavrvdpkklsqreleel
    srgyaraiapligdvvdipapdvgtnaqimawmvdeyskikgynvpgvftskppelwgnp
    vreyatgfgvavatremakklwggiegktvaiqgmgnvgrwtaywlekmgakviavsdin
    gvayrkeglnveliqknkgltgpalvelfttkdnaefvknpdaifkldvdifvpaaienv
    irgdnaglvkarlvvegangpttpeaerilyergvvvvpdilanaggvimsylewvenlq
    wyiwdeeetrkrlenimvnnvervykrwqrekgwtmrdaaivtaleriynamkirgwi
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1v9lC (C:)
    mertgfleyvlnyvkkgvelggfpedfykilsrprrvlivnipvrldgggfevfegyrvq
    hcdvlgpykggvrfhpevtladdvalailmtlknslaglpyggakgavrvdpkklsqrel
    eelsrgyaraiapligdvvdipapdvgtnaqimawmvdeyskikgynvpgvftskppelw
    gnpvreyatgfgvavatremakklwggiegktvaiqgmgnvgrwtaywlekmgakviavs
    dingvayrkeglnveliqknkgltgpalvelfttkdnaefvknpdaifkldvdifvpaai
    envirgdnaglvkarlvvegangpttpeaerilyergvvvvpdilanaggvimsylewve
    nlqwyiwdeeetrkrlenimvnnvervykrwqrekgwtmrdaaivtaleriynamkirgw
    i
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v9lC (C:)
    tgfleyvlnyvkkgvelggfpedfykilsrprrvlivnipvrldgggfevfegyrvqhcd
    vlgpykggvrfhpevtladdvalailmtlknslaglpyggakgavrvdpkklsqreleel
    srgyaraiapligdvvdipapdvgtnaqimawmvdeyskikgynvpgvftskppelwgnp
    vreyatgfgvavatremakklwggiegktvaiqgmgnvgrwtaywlekmgakviavsdin
    gvayrkeglnveliqknkgltgpalvelfttkdnaefvknpdaifkldvdifvpaaienv
    irgdnaglvkarlvvegangpttpeaerilyergvvvvpdilanaggvimsylewvenlq
    wyiwdeeetrkrlenimvnnvervykrwqrekgwtmrdaaivtaleriynamkirgwi
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1v9lD (D:)
    mertgfleyvlnyvkkgvelggfpedfykilsrprrvlivnipvrldgggfevfegyrvq
    hcdvlgpykggvrfhpevtladdvalailmtlknslaglpyggakgavrvdpkklsqrel
    eelsrgyaraiapligdvvdipapdvgtnaqimawmvdeyskikgynvpgvftskppelw
    gnpvreyatgfgvavatremakklwggiegktvaiqgmgnvgrwtaywlekmgakviavs
    dingvayrkeglnveliqknkgltgpalvelfttkdnaefvknpdaifkldvdifvpaai
    envirgdnaglvkarlvvegangpttpeaerilyergvvvvpdilanaggvimsylewve
    nlqwyiwdeeetrkrlenimvnnvervykrwqrekgwtmrdaaivtaleriynamkirgw
    i
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v9lD (D:)
    tgfleyvlnyvkkgvelggfpedfykilsrprrvlivnipvrldgggfevfegyrvqhcd
    vlgpykggvrfhpevtladdvalailmtlknslaglpyggakgavrvdpkklsqreleel
    srgyaraiapligdvvdipapdvgtnaqimawmvdeyskikgynvpgvftskppelwgnp
    vreyatgfgvavatremakklwggiegktvaiqgmgnvgrwtaywlekmgakviavsdin
    gvayrkeglnveliqknkgltgpalvelfttkdnaefvknpdaifkldvdifvpaaienv
    irgdnaglvkarlvvegangpttpeaerilyergvvvvpdilanaggvimsylewvenlq
    wyiwdeeetrkrlenimvnnvervykrwqrekgwtmrdaaivtaleriynamkirgwi
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1v9lE (E:)
    mertgfleyvlnyvkkgvelggfpedfykilsrprrvlivnipvrldgggfevfegyrvq
    hcdvlgpykggvrfhpevtladdvalailmtlknslaglpyggakgavrvdpkklsqrel
    eelsrgyaraiapligdvvdipapdvgtnaqimawmvdeyskikgynvpgvftskppelw
    gnpvreyatgfgvavatremakklwggiegktvaiqgmgnvgrwtaywlekmgakviavs
    dingvayrkeglnveliqknkgltgpalvelfttkdnaefvknpdaifkldvdifvpaai
    envirgdnaglvkarlvvegangpttpeaerilyergvvvvpdilanaggvimsylewve
    nlqwyiwdeeetrkrlenimvnnvervykrwqrekgwtmrdaaivtaleriynamkirgw
    i
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v9lE (E:)
    tgfleyvlnyvkkgvelggfpedfykilsrprrvlivnipvrldgggfevfegyrvqhcd
    vlgpykggvrfhpevtladdvalailmtlknslaglpyggakgavrvdpkklsqreleel
    srgyaraiapligdvvdipapdvgtnaqimawmvdeyskikgynvpgvftskppelwgnp
    vreyatgfgvavatremakklwggiegktvaiqgmgnvgrwtaywlekmgakviavsdin
    gvayrkeglnveliqknkgltgpalvelfttkdnaefvknpdaifkldvdifvpaaienv
    irgdnaglvkarlvvegangpttpeaerilyergvvvvpdilanaggvimsylewvenlq
    wyiwdeeetrkrlenimvnnvervykrwqrekgwtmrdaaivtaleriynamkirgwi
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1v9lF (F:)
    mertgfleyvlnyvkkgvelggfpedfykilsrprrvlivnipvrldgggfevfegyrvq
    hcdvlgpykggvrfhpevtladdvalailmtlknslaglpyggakgavrvdpkklsqrel
    eelsrgyaraiapligdvvdipapdvgtnaqimawmvdeyskikgynvpgvftskppelw
    gnpvreyatgfgvavatremakklwggiegktvaiqgmgnvgrwtaywlekmgakviavs
    dingvayrkeglnveliqknkgltgpalvelfttkdnaefvknpdaifkldvdifvpaai
    envirgdnaglvkarlvvegangpttpeaerilyergvvvvpdilanaggvimsylewve
    nlqwyiwdeeetrkrlenimvnnvervykrwqrekgwtmrdaaivtaleriynamkirgw
    i
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v9lF (F:)
    tgfleyvlnyvkkgvelggfpedfykilsrprrvlivnipvrldgggfevfegyrvqhcd
    vlgpykggvrfhpevtladdvalailmtlknslaglpyggakgavrvdpkklsqreleel
    srgyaraiapligdvvdipapdvgtnaqimawmvdeyskikgynvpgvftskppelwgnp
    vreyatgfgvavatremakklwggiegktvaiqgmgnvgrwtaywlekmgakviavsdin
    gvayrkeglnveliqknkgltgpalvelfttkdnaefvknpdaifkldvdifvpaaienv
    irgdnaglvkarlvvegangpttpeaerilyergvvvvpdilanaggvimsylewvenlq
    wyiwdeeetrkrlenimvnnvervykrwqrekgwtmrdaaivtaleriynamkirgwi