PDB entry 1v9j

View 1v9j on RCSB PDB site
Description: solution structure of a bola-like protein from mus musculus
Deposited on 2004-01-26, released 2004-02-10
The last revision prior to the SCOP 1.67 freeze date was dated 2004-02-10, with a file datestamp of 2004-02-10.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1v9ja_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v9jA (A:)
    mkgsshhhhhhssgaslvprgsegaatmelsadylreklrqdleaehvevedttlnrcat
    sfrvlvvsakfegkpllqrhrlvneclaeelphihafeqktltpeqwtrqrre